DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and Uck2

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_038946718.1 Gene:Uck2 / 304944 RGDID:620742 Length:267 Species:Rattus norvegicus


Alignment Length:170 Identity:33/170 - (19%)
Similarity:65/170 - (38%) Gaps:46/170 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LLTILRDKNTTRSDFKF-YADRLIRLVIEESLNQLPYTHCDVETPTGAIYEGLKYRSGNCGVSII 137
            :||..:.....:..|.| :.|.....:|.::|.::    .:.:|....:|:.:.:......|:|.
  Rat    73 VLTSEQKAKALKGQFNFDHPDAFDNELIFKTLKEI----TEGKTVQIPVYDFVSHSRKEETVTIY 133

  Fly   138 RSGEAMEQGL--------RDCCRSIRIGKILVESDANTHEARVVYARFPDDIGSR-----QVLLM 189
            .:...:.:|:        ||..:.    |:.|::||:|..:|    |...||..|     |:|..
  Rat   134 PADVVLFEGILAFYSQEVRDLFQM----KLFVDTDADTRLSR----RVLRDISERGRDLEQILSQ 190

  Fly   190 Y--------------------PIMSTGNTVLQAVNVLREH 209
            |                    .|:..|...|.|:|::.:|
  Rat   191 YITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQH 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 33/170 (19%)
Uck2XP_038946718.1 UMPK 38..234 CDD:238981 33/170 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.