DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and SPAC1399.04c

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_593510.1 Gene:SPAC1399.04c / 2542614 PomBaseID:SPAC1399.04c Length:220 Species:Schizosaccharomyces pombe


Alignment Length:212 Identity:78/212 - (36%)
Similarity:124/212 - (58%) Gaps:10/212 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EYGSNLKLLECNSQVAELLTILRDKNTTRSDFKFYADRLIRLVIEESLNQLPYTHCDVETPTGAI 121
            |...|:.:|.....:..|:|||||:.|..|:|...|:.:|.::::|:|:.|||..|.::|.:|..
pombe     6 EQPENVVVLRQTMYLLSLMTILRDQQTGHSEFVRTANLIINMLMQEALSALPYKKCLIKTSSGGT 70

  Fly   122 YEGLKYRSGNCGVSIIRSGEAMEQGLRDCCR-SIRIGKILVESDANTHEARVVYARFPDDIGSRQ 185
            |.|::.....|||||:|:||:||.||...|. |:.:||:||:.|..|.||::::.:.|.|...|.
pombe    71 YTGVQPARDICGVSILRAGESMEYGLAAACNYSVPVGKLLVQRDETTFEAKLMFCKLPKDAQDRL 135

  Fly   186 VLLMYPIMSTGNTVLQAVNVLREHGVPESCIILSNLFCTPIAARTVVNAFPKLKILTSELHP--- 247
            |||:.|:::|||:|:.|:..|...|:||..|:..||.........|...||||:::|:.:.|   
pombe   136 VLLLDPLLATGNSVILAIQTLINKGIPEENIVFVNLIACNEGITNVFAKFPKLRMVTASIDPELN 200

  Fly   248 ----VAP--NHFGQKYF 258
                |.|  ..||.:||
pombe   201 ANKYVVPGCGDFGDRYF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 68/175 (39%)
SPAC1399.04cNP_593510.1 UPRTase 16..219 CDD:291353 75/202 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1189
OMA 1 1.010 - - QHG53753
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.830

Return to query results.
Submit another query.