DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and SPCC162.11c

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001342737.1 Gene:SPCC162.11c / 2538946 PomBaseID:SPCC162.11c Length:454 Species:Schizosaccharomyces pombe


Alignment Length:235 Identity:70/235 - (29%)
Similarity:114/235 - (48%) Gaps:26/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QQLHTPTHAHAAVPAATSEEILAEYGSNLKLLECNSQVAELLTILRDKNTTRSDFKFYADRLIRL 98
            ||: .||..|..:              ||..|:...:::.:.|||.:|||...|.:|:..|:..:
pombe   238 QQI-VPTIPHLPL--------------NLVQLKITPEISAIRTILINKNTHPDDLQFFLSRIGTM 287

  Fly    99 VIEESLNQLPYTHCDVETPTGAIYEGLKYRSGNCGVSIIRSGEAMEQGLRDCCR---SIRIGKIL 160
            ::..:.:.|.|....:....|..:|||:.....||||::|||..:|..|   ||   ::.:||||
pombe   288 LMNLAGDSLAYEKKTITLHNGNQWEGLQMAKELCGVSVLRSGGTLETAL---CRQFPTVCLGKIL 349

  Fly   161 VESDANTHEARVVYARFPDDIGSRQVLLMYPIMSTGNTVLQAVNVLREHGVPESCIILSNLFCTP 225
            |:.:..|.|..:.|.:.|..|.:..|:||...::|...||.|..:|.:.||||..||:....|..
pombe   350 VQINKVTQEPTLHYHKLPRGIATMNVVLMASHLTTHADVLMATQILVDFGVPEENIIIVVYVCYS 414

  Fly   226 IAARTVVNAFPKLKILTSELHPVAPNHFG-----QKYFDC 260
            .:.:.:...|||:.|:|:.|..||....|     :.|:.|
pombe   415 ESIKALAYIFPKVTIVTAFLESVAEPVVGRLDIEKVYYGC 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 56/177 (32%)
SPCC162.11cNP_001342737.1 UMPK 23..220 CDD:238981
Upp 250..454 CDD:223113 64/206 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.