DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and Uck1

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001365720.1 Gene:Uck1 / 22245 MGIID:98904 Length:301 Species:Mus musculus


Alignment Length:297 Identity:51/297 - (17%)
Similarity:99/297 - (33%) Gaps:89/297 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SSSGSQSEEGSSSSDHQQPQQEAQEQEQQLHTPTHAHAAVPAATSEEILAEYGSN--------LK 63
            |:.|..||..:..:|..||:       ..|...:...|:..:...|:|:...|.|        |.
Mouse     9 SAGGGGSESAAPEADRPQPR-------PFLIGVSGGTASGKSTVCEKIMELLGQNEVDRRQRKLV 66

  Fly    64 LL--ECNSQVAELLTILRDKNTTRSDFKF-YAD--------RLIRLVIEESLNQLP----YTHCD 113
            :|  :|..:|   ||..:.....:..:.| :.|        :.::.::|....::|    .||..
Mouse    67 ILSQDCFYKV---LTAEQKAKALKGQYNFDHPDAFDNDLMHKTLKNIVEGKTVEVPTYDFVTHSR 128

  Fly   114 VETPT------GAIYEGLKYRSGNCGVSIIRSGEAMEQGLRDCCRSIRIGKILVESDANTHEARV 172
            :...|      ..::||:..              ...|.:||....    ::.|::|::...:|.
Mouse   129 LPETTVVYPADVVLFEGILV--------------FYTQEIRDMFHL----RLFVDTDSDVRLSRR 175

  Fly   173 VYARFPDDIGSRQVLLMY-------------PIMSTGNTVL-QAVNVLREH------GVPESCII 217
            |...........|:|..|             |.....:.:: :.|:.:.:.      ..|..|::
Mouse   176 VLRDVQRGRDLEQILTQYTAFVKPAFEEFCLPTKKYADVIIPRGVDNMADQARTLDCACPVGCLL 240

  Fly   218 LSNLFCTPIAARTVVNAFPKLKILTSEL---HPVAPN 251
                   |:|...:|....  .||..:|   |...||
Mouse   241 -------PVAINLIVQHIQ--DILNGDLCKRHRGGPN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 31/213 (15%)
Uck1NP_001365720.1 UMPK 31..254 CDD:238981 38/252 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.