DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and F19B6.1

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001368094.1 Gene:F19B6.1 / 178181 WormBaseID:WBGene00008948 Length:569 Species:Caenorhabditis elegans


Alignment Length:207 Identity:70/207 - (33%)
Similarity:119/207 - (57%) Gaps:9/207 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NLKLLECNSQVAELLTILRDKNTTRSDFKFYADRLIRLVIEESLNQLPYTHCDVETPTGAIYEGL 125
            ||.:|:...||..|:|.:||:.|:|.:..||:|||:|::|||.:|.:||...::|...|....|.
 Worm   349 NLFILKETPQVKGLVTFVRDRETSRDNHIFYSDRLMRILIEECMNHMPYKDVEIEMAGGRKTIGK 413

  Fly   126 KYRSGNCGVSIIRSGEAMEQGLRDCCRSIRIGKILVESDANTHEARVVYARFPDDIGSRQVLLMY 190
            :..:..||:.|:|:||.||..||...:...|||||::::..|.:..:.|.|.|..|...:|::|.
 Worm   414 RKDAQICGLPIMRAGECMETALRSIVKDCVIGKILIQTNETTFDPELHYIRLPPHITRYKVIIMD 478

  Fly   191 PIMSTGNTVLQAVNVLREHGVPESCIILSNLFCTPIAARTVVNAFPKLKILTSEL-HPVAPN--- 251
            ..::||:..:.|:.||.:|.|.|..|.:::|......|..:..||||:|::|:.: |.:..|   
 Worm   479 ATVTTGSAAMMAIRVLLDHDVKEEDIFVASLLMGQQGAHALAYAFPKVKLITTAMDHQMTENCYL 543

  Fly   252 -----HFGQKYF 258
                 :||.:|:
 Worm   544 IPGMGNFGDRYY 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 62/174 (36%)
F19B6.1NP_001368094.1 UMPK 120..319 CDD:238981
UPRTase 355..557 CDD:405383 67/201 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.