DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and B0001.4

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_502304.2 Gene:B0001.4 / 178160 WormBaseID:WBGene00007089 Length:248 Species:Caenorhabditis elegans


Alignment Length:180 Identity:34/180 - (18%)
Similarity:63/180 - (35%) Gaps:49/180 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SEEGSSSSDHQQPQQEAQEQEQQLHTPTHAHAAVPAATSEEILAEYGSNL---KLLECNSQVAEL 74
            :.||..:.||                        |...:.::|||...|:   |.:|....  ::
 Worm    65 AREGKFNFDH------------------------PDQINFDLLAETLQNMIDGKTVEIPKY--DM 103

  Fly    75 LTILRDKNTTRSDFKFYADRLIRLVIEESLNQLPYTHCDVETPTGAIYEGLKYRSGN-------- 131
            :|...:...|....|......|.|:.:|.:.:|..|...||       :..:.|..|        
 Worm   104 ITSSMNGTVTVEPAKVIIIEGILLLYDERVRKLLSTKLFVE-------KNAESRLRNRLATYIRD 161

  Fly   132 ---CGVSIIRS-GEAMEQGLRDCCR-SIRIGKILVESDANTHEARVVYAR 176
               ..:||||. .|.::....:.|| :.:...:::...|:.|.|..:.|:
 Worm   162 YHRAPLSIIRQYTEFVKPAFEEFCRPTKKYADVIIPRGADNHVATDLIAK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 23/120 (19%)
B0001.4NP_502304.2 Udk 1..223 CDD:223645 34/180 (19%)
UMPK 10..216 CDD:238981 34/180 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.