DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and uck2

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001120241.1 Gene:uck2 / 100145292 XenbaseID:XB-GENE-942591 Length:261 Species:Xenopus tropicalis


Alignment Length:234 Identity:51/234 - (21%)
Similarity:83/234 - (35%) Gaps:94/234 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GSSSSDHQQPQ--QEAQEQEQQLHTPTHAHAAV--------PAATSEEILAEYGSNLKLLECNSQ 70
            |.:..||.|.|  ..:|:...::.||.....|:        |.|...|::      ||.|:    
 Frog    44 GQNEVDHHQKQVVMLSQDSFYRILTPEQKSKALKGQFNFDHPDAFDNELI------LKTLK---- 98

  Fly    71 VAELLTILRDKNTTR---SDFKFYADRLIRLVIEESLNQLPYTHCDVETPTGAIYEGLK--YRSG 130
              ||:    :..|.:   .||..::.:      ||:|...|   .||     .::||:.  |.  
 Frog    99 --ELM----EGKTVQIPVYDFVTHSRK------EETLVVYP---ADV-----VLFEGILAFYM-- 141

  Fly   131 NCGVSIIRSGEAMEQGLRDCCRSIRIGKILVESDANTHEARVVYARFPDDIGSR-----QVLLMY 190
                          |.:||..:.    |:.|::||:|..:|    |...||..|     |||..|
 Frog   142 --------------QEIRDMFQM----KLFVDTDADTRLSR----RVLRDINERGRDLEQVLTQY 184

  Fly   191 --------------------PIMSTGNTVLQAVNVLREH 209
                                .|:..|...:.|:|::.:|
 Frog   185 ITFVKPAFEEFCLPTKKYADVIIPRGADNVVAINLIVQH 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 36/170 (21%)
uck2NP_001120241.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
UMPK 21..227 CDD:238981 51/234 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.