DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and RPS6KA4

DIOPT Version :9

Sequence 1:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_003933.1 Gene:RPS6KA4 / 8986 HGNCID:10433 Length:772 Species:Homo sapiens


Alignment Length:427 Identity:198/427 - (46%)
Similarity:261/427 - (61%) Gaps:39/427 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DSDDDRIELDDVDLEPELCINLHQDTEGQETIQLCEENVNPGKIKLGPKDFELKKVLGKGGYGKV 91
            |.|||           |.|         ...:::.|.|:...:.|:..::|||.||||.|.||||
Human     3 DEDDD-----------ESC---------AVELRITEANLTGHEEKVSVENFELLKVLGTGAYGKV 47

  Fly    92 FQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKH-PFIVELVYAFQTDGKLY 155
            |.|||..|.||.|.:|||||:||::|...|...|||.||::||.|:. ||:|.|.||||||.||:
Human    48 FLVRKAGGHDAGKLYAMKVLRKAALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAFQTDAKLH 112

  Fly   156 LILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKL 220
            |||:|:||||:|.||.:...|.|.....|..||:|||.|||||||||||||.||:|||::||:.|
Human   113 LILDYVSGGEMFTHLYQRQYFKEAEVRVYGGEIVLALEHLHKLGIIYRDLKLENVLLDSEGHIVL 177

  Fly   221 TDFGLCKEHI-QEGIVTHTFCGTIEYMAPEIL-TRSGHGKAVDWWSLGALMFDMLTGVPPFTAEN 283
            |||||.||.: :|...|.:||||||||||||: :::||||||||||||.|:|::|||..|||.|.
Human   178 TDFGLSKEFLTEEKERTFSFCGTIEYMAPEIIRSKTGHGKAVDWWSLGILLFELLTGASPFTLEG 242

  Fly   284 RKKT----IETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKHVNWD 344
            .:.|    ...|||.....|..:.|.|:||::||:.:...:|||:||:.|..|:.||||:.::|.
Human   243 ERNTQAEVSRRILKCSPPFPPRIGPVAQDLLQRLLCKDPKKRLGAGPQGAQEVRNHPFFQGLDWV 307

  Fly   345 DVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIPVDSPDDTTLSESANLIFQGFTYVAPSILEDMH 409
            .:.||::..|.:|.:|||.||..|...|||..||.||..:....... ||||:::||||||.|.:
Human   308 ALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPGSPPPGDPR-IFQGYSFVAPSILFDHN 371

  Fly   410 R-----------ANRMPARSPRRTPRQLPDSSFRLQF 435
            .           |...|.|:.......:.||.|..|:
Human   372 NAVMTDGLEAPGAGDRPGRAAVARSAMMQDSPFFQQY 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 174/327 (53%)
STKc_p70S6K 81..402 CDD:270736 173/327 (53%)
RPS6KA4NP_003933.1 STKc_MSK2_N 32..364 CDD:270765 176/332 (53%)
S_TKc 33..301 CDD:214567 151/267 (57%)
PKc_like 404..714 CDD:304357 2/5 (40%)
S_TKc 417..674 CDD:214567
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 673..696
Required for nuclear targeting and association with MAPK14 725..772
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 728..772
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1132245at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.880

Return to query results.
Submit another query.