DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and YPK1

DIOPT Version :9

Sequence 1:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_012796.1 Gene:YPK1 / 853733 SGDID:S000001609 Length:680 Species:Saccharomyces cerevisiae


Alignment Length:413 Identity:174/413 - (42%)
Similarity:247/413 - (59%) Gaps:31/413 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PSELFDLELHDLELQDDKARDSDDDRIELDDVDLEP-ELCINLHQDTE----------------- 53
            ||:.:..|   :.|||:|.:...|......|:.|:. .|.|||..|:.                 
Yeast   264 PSKTWQQE---MGLQDEKLQTIFDKINSNQDIHLDSFHLPINLSFDSAASIRLYNHHWITLDNGL 325

  Fly    54 GQETIQLCEENVNPGKIK-LGPKDFELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIV 117
            |:..|.:   :..|.:.| |...||:|.||:|||.:|||.||||   :|..|.:|:|.::|:.||
Yeast   326 GKINISI---DYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRK---KDTQKVYALKAIRKSYIV 384

  Fly   118 TNQKDTAHTRAERNILEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTC 182
             ::.:..||.|||.:|..|..||||.|.::||:..|||.:|.:::|||||.||::||.|......
Yeast   385 -SKSEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRAR 448

  Fly   183 FYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMA 247
            ||.:|::.||.:||||.::||||||||||||.|||:.|.||||||.::::...|.|||||.||:|
Yeast   449 FYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLA 513

  Fly   248 PEILTRSGHGKAVDWWSLGALMFDMLTGVPPFTAENRKKTIETILKAKLNLPAYLTPEARDLVRR 312
            ||:|...|:.||||||:||.|:::||||:||:..|:..|..:.||:..|..|.....:|:||:..
Yeast   514 PELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLVFPDGFDRDAKDLLIG 578

  Fly   313 LMKRQEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIP 377
            |:.|...:|||....|  .::.||||..::|..:|.:...||.||.:.:..|.|.||..|||:.|
Yeast   579 LLSRDPTRRLGYNGAD--EIRNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDEEFTREKP 641

  Fly   378 VDSPDDTTLSESANLIFQGFTYV 400
            :||..|..||||....|.|:|||
Yeast   642 IDSVVDEYLSESVQKQFGGWTYV 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 150/320 (47%)
STKc_p70S6K 81..402 CDD:270736 151/320 (47%)
YPK1NP_012796.1 YPK1_N_like 116..342 CDD:212165 19/83 (23%)
PKc_like 352..663 CDD:419665 147/316 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 301 1.000 Inparanoid score I499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9248
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.