DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and S6K2

DIOPT Version :9

Sequence 1:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001327294.1 Gene:S6K2 / 820019 AraportID:AT3G08720 Length:471 Species:Arabidopsis thaliana


Alignment Length:395 Identity:162/395 - (41%)
Similarity:251/395 - (63%) Gaps:26/395 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HDLELQDDKARDSDD-----DRIELDDVDLEPELCINLHQDTEGQETIQLCEENVNPGKIK--LG 73
            |.|::.....|:::|     :.:|.:.:....|...|  .||:.::         :|.::.  :|
plant    83 HSLKMNKLTLRETEDSVDLVECVEGESIKENDEFSGN--DDTDSEK---------SPEEVSGVVG 136

  Fly    74 PKDFELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTA-HTRAERNILEAVK 137
            .:|||:.||:|:|.:|||:||||   :|.::.:||||::|..||  :|:.| :.:|||:||..:.
plant   137 IEDFEVLKVVGQGAFGKVYQVRK---KDTSEIYAMKVMRKDKIV--EKNHAEYMKAERDILTKID 196

  Fly   138 HPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIY 202
            |||||:|.|:|||..:|||:|::::||.||..|..:|:|.||....|.:||:.|:.|||:.||::
plant   197 HPFIVQLKYSFQTKYRLYLVLDFINGGHLFFQLYHQGLFREDLARVYTAEIVSAVSHLHEKGIMH 261

  Fly   203 RDLKPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGA 267
            |||||||||:|..|||.||||||.|| .:|...:::.|||.|||||||:...||.||.||||:|.
plant   262 RDLKPENILMDVDGHVMLTDFGLAKE-FEENTRSNSMCGTTEYMAPEIVRGKGHDKAADWWSVGI 325

  Fly   268 LMFDMLTGVPPFTAENRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAV 332
            |:::||||.|||.. ::.|..:.|:|.|:.||.:|:.||..|::.|::::..:||||||..|..:
plant   326 LLYEMLTGKPPFLG-SKGKIQQKIVKDKIKLPQFLSNEAHALLKGLLQKEPERRLGSGPSGAEEI 389

  Fly   333 QIHPFFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIPVDSPDDTTLSESANLIFQGF 397
            :.|.:||.:||..:.||.::|..||.:.....::.||..:|....:|||..:..|::....|..|
plant   390 KKHKWFKAINWKKLEAREVQPSFKPAVSGRQCIANFDKCWTDMSVLDSPASSPNSDAKANPFTNF 454

  Fly   398 TYVAP 402
            |||.|
plant   455 TYVRP 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 146/321 (45%)
STKc_p70S6K 81..402 CDD:270736 147/321 (46%)
S6K2NP_001327294.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 259 1.000 Domainoid score I491
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H81703
Inparanoid 1 1.050 302 1.000 Inparanoid score I779
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1132245at2759
OrthoFinder 1 1.000 - - FOG0001793
OrthoInspector 1 1.000 - - mtm1096
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1494
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.