DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and Rps6ka6

DIOPT Version :9

Sequence 1:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_080225.2 Gene:Rps6ka6 / 67071 MGIID:1914321 Length:860 Species:Mus musculus


Alignment Length:416 Identity:187/416 - (44%)
Similarity:259/416 - (62%) Gaps:35/416 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SDPSELFDL-------------ELHDLELQDDKARDSDDDRIELDDVDLEPELCINLHQDTEGQE 56
            |:|..:|.:             |::||::.|:...:.:.  :.....:|..|:.|..|       
Mouse   121 SEPQVVFTMKNAATVMREHERKEVNDLKMVDEPMEEGEP--VSCRREELVKEIPITQH------- 176

  Fly    57 TIQLCEENVNPGKIKLGPKDFELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQK 121
                    |..|..|..|..|:|.||||:|.:||||.|||..|.||.:.:|||||:|||:  ..:
Mouse   177 --------VKEGYEKADPAQFDLLKVLGQGSFGKVFLVRKKTGPDAGQLYAMKVLRKASL--KVR 231

  Fly   122 DTAHTRAERNILEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLS 186
            |...|:.||:||..|.|||||:|.|||||:|||||||::|.||::|..|.:|.:|.|:...|||:
Mouse   232 DRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVLFTEEDVKFYLA 296

  Fly   187 EIILALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEIL 251
            |:.|||.|||:|||:||||||||||||..||:|||||||.||.:.:....::||||:||||||::
Mouse   297 ELALALDHLHRLGIVYRDLKPENILLDEIGHIKLTDFGLSKESVDQEKKAYSFCGTVEYMAPEVV 361

  Fly   252 TRSGHGKAVDWWSLGALMFDMLTGVPPFTAENRKKTIETILKAKLNLPAYLTPEARDLVRRLMKR 316
            .|.||.::.||||.|.|||:||||..||..::|.:|:..||||||.:|.:|:.||:.|:|.|.||
Mouse   362 NRRGHSQSADWWSYGVLMFEMLTGTLPFQGKDRNETMNMILKAKLGMPQFLSAEAQSLLRMLFKR 426

  Fly   317 QEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIPVDSP 381
            ....||||  |....|:.|.||..::|:.:..|.::||.:|.....||...||..||.:.|.|||
Mouse   427 NPANRLGS--EGVEEVKRHAFFASIDWNKLYKREVQPPFRPASGKPDDTFCFDPEFTAKTPKDSP 489

  Fly   382 DDTTLSESANLIFQGFTYVAPSILED 407
             ....|.:|:.:|:||::||.||.|:
Mouse   490 -GLPASANAHQLFKGFSFVATSIAEE 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 165/320 (52%)
STKc_p70S6K 81..402 CDD:270736 166/320 (52%)
Rps6ka6NP_080225.2 STKc_RSK_N 193..507 CDD:270734 165/318 (52%)
STKc_RSK_C 542..828 CDD:270993
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1132245at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.