DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and RPS6KA2

DIOPT Version :9

Sequence 1:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_006715612.1 Gene:RPS6KA2 / 6196 HGNCID:10431 Length:761 Species:Homo sapiens


Alignment Length:375 Identity:184/375 - (49%)
Similarity:252/375 - (67%) Gaps:12/375 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EPELCINLHQDTEGQETIQLCEENVNPGKIKLGPKDFELKKVLGKGGYGKVFQVRKTAGRDANKY 105
            |||   ..|::....:.|.: ..:|..|..|..|..|||.||||:|.|||||.|||..|.||.:.
Human    55 EPE---TQHEEEGVVKEIDI-SHHVKEGFEKADPSQFELLKVLGQGSYGKVFLVRKVKGSDAGQL 115

  Fly   106 FAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELFMHL 170
            :||||||||::  ..:|...::.||:||..|.|||||:|.|||||:|||||||::|.||:||..|
Human   116 YAMKVLKKATL--KVRDRVRSKMERDILAEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRL 178

  Fly   171 EREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLCKEHIQEGIV 235
            .:|.:|.|:...|||:|:.|||.|||.||||||||||||||||.:||:|:|||||.||.|.....
Human   179 SKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKR 243

  Fly   236 THTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMFDMLTGVPPFTAENRKKTIETILKAKLNLPA 300
            .::|||||||||||::.|.||.::.||||.|.|||:||||..||..::||:|:..||||||.:|.
Human   244 AYSFCGTIEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQ 308

  Fly   301 YLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLARRLEPPIKPLLRSEDDV 365
            :|:.||:.|:|.|.||....|||:|.:....::.||||..::|:.:..:.::||.||.:...:|.
Human   309 FLSGEAQSLLRALFKRNPCNRLGAGIDGVEEIKRHPFFVTIDWNTLYRKEIKPPFKPAVGRPEDT 373

  Fly   366 SQFDTRFTRQIPVDSPDDTTLSESANLIFQGFTYVAPSIL-----EDMHR 410
            ..||..||.:.|.||| ....|.:|:.:|:||::||.|::     :|:|:
Human   374 FHFDPEFTARTPTDSP-GVPPSANAHHLFRGFSFVASSLIQEPSQQDLHK 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 168/320 (53%)
STKc_p70S6K 81..402 CDD:270736 168/320 (53%)
RPS6KA2XP_006715612.1 S_TKc 87..346 CDD:214567 149/260 (57%)
STKc_RSK_N 91..407 CDD:270734 167/318 (53%)
STKc_RSK3_C 439..731 CDD:271080
Pkinase 443..700 CDD:278497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140572
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1132245at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.