DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and Stk32c

DIOPT Version :9

Sequence 1:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_067277.2 Gene:Stk32c / 57740 MGIID:2385336 Length:488 Species:Mus musculus


Alignment Length:337 Identity:105/337 - (31%)
Similarity:174/337 - (51%) Gaps:34/337 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 FELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFI 141
            |::.:.:|||.:|||..|:|   ||..|.:|||.:.|...: .:.:..:...|..||:.::|.|:
Mouse    94 FQILRAIGKGSFGKVCIVQK---RDTEKMYAMKYMNKQQCI-ERDEVRNVFRELEILQEIEHVFL 154

  Fly   142 VELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLK 206
            |.|.|:||.:..::::::.|.||:|..||::...|.|||...|:.|:.|||.:|....||:||:|
Mouse   155 VNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVQFSEDTVRLYICEMALALDYLRSQHIIHRDVK 219

  Fly   207 PENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTR-----SGHGKAVDWWSLG 266
            |:|||||.|||..||||.:. ..|::|.......||..||||||...     :|:...|||||:|
Mouse   220 PDNILLDEQGHAHLTDFNIA-TIIKDGERATALAGTKPYMAPEIFHSFVNGGTGYSFEVDWWSVG 283

  Fly   267 ALMFDMLTGVPPFTAENRKKTIETILKAKLNLPAYLTP----EARDLVRRLMKRQEPQRLGSGPE 327
            .:.:::|.|..|:...: ...:|::::....:.....|    |...|:|:|: ...|:...|..:
Mouse   284 VMAYELLRGWRPYDIHS-SNAVESLVQLFSTVSVQYVPTWSKEMVALLRKLL-TVNPEHRFSSLQ 346

  Fly   328 DAAAVQIHPFFKHVNWDDVLARRLEPPIKP---------------LLRSEDDVSQFDTRFTRQIP 377
            |   :|..|...||.|||:..:::||...|               ::.....:.:...|..:...
Mouse   347 D---MQTAPSLAHVLWDDLSEKKVEPGFVPNKGRLHCDPTFELEEMILESRPLHKKKKRLAKNKS 408

  Fly   378 VDSPDDTTLSES 389
            .||..|::.||:
Mouse   409 RDSSRDSSQSEN 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 105/337 (31%)
STKc_p70S6K 81..402 CDD:270736 104/333 (31%)
Stk32cNP_067277.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
STKc_Yank1 93..352 CDD:270730 90/267 (34%)
S_TKc 94..349 CDD:214567 89/264 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..420 5/22 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..488
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.