DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and S6KL

DIOPT Version :9

Sequence 1:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster


Alignment Length:347 Identity:115/347 - (33%)
Similarity:174/347 - (50%) Gaps:69/347 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 FELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVK---- 137
            :.:..::.||.:|.||:|  ::..|.::.:|:|||||:.::           |.|.:..:|    
  Fly   159 YRIDHLVAKGAFGVVFKV--SSKSDISQCYALKVLKKSKLI-----------EDNSVRQIKDEAD 210

  Fly   138 -------HPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHL 195
                   |||||:.:..:|....|:::.||:..||||..:..   |..|....|:.||.|||..|
  Fly   211 IQKVCGHHPFIVKQIDLWQNRHNLHILSEYVPNGELFSKITH---FSIDLVRLYIGEIALALDFL 272

  Fly   196 HKLGIIYRDLKPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAV 260
            |..||||||.|||||||..|.|:|||||||.| .::.|..|.|.|||.:|||||||....:|.||
  Fly   273 HNAGIIYRDAKPENILLTEQFHIKLTDFGLSK-WLKLGANTRTMCGTFKYMAPEILCGEPYGHAV 336

  Fly   261 DWWSLGALMFDMLTGVPPFTAEN---RKKTIE---------TILKAKLN-------------LP- 299
            |||:||.:...|||...|....:   |::::|         :|  |::|             || 
  Fly   337 DWWALGVIACQMLTQKSPNIKRHLLRRRESVEPEDGLSNAPSI--AQINGCLQDSDGDSEDFLPE 399

  Fly   300 --AYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLARRLEPPIKPLLRSE 362
              .:||.|.||::|:|:..:..||:.|    ..|:|....:|..|........|.|  :.:: :.
  Fly   400 EVQHLTHEGRDVLRKLLTIEPRQRIRS----VMALQRIAIYKDYNLSSKQLLSLSP--REII-AR 457

  Fly   363 DDVSQFDTR----FTRQIPVDS 380
            |.:..::.|    .|.|..:|:
  Fly   458 DGIRIYEDRHFDQLTNQCAIDA 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 115/347 (33%)
STKc_p70S6K 81..402 CDD:270736 115/343 (34%)
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 105/294 (36%)
STKc_AGC 167..>354 CDD:270693 86/203 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.