DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and CG12069

DIOPT Version :10

Sequence 1:NP_523941.2 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_651819.1 Gene:CG12069 / 43643 FlyBaseID:FBgn0039796 Length:356 Species:Drosophila melanogaster


Alignment Length:144 Identity:35/144 - (24%)
Similarity:56/144 - (38%) Gaps:19/144 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   444 KLNQRFYALRSVVPNISKMDKASLLGDAVSYINELHAKLK--VMEAERERLGYSSNPPISLDSDI 506
            |||. ::....|.|...:.|:...  |..:.:.|...|||  :|:|   ::.:...|.:..|:..
  Fly   173 KLNV-YFETDEVYPLKQQADQEQY--DTEANLTECAKKLKGQLMDA---KILFDGAPKLGADTVE 231

  Fly   507 NVQTSGEDVTVRINCPLESHPASRIFHAFEESKVEVINSNLE----VSQDTVLH---TFVVKSEE 564
            .|.|.........|..|   |.|....| .|:|:|.....|:    ||....:|   ||......
  Fly   232 GVLTMKNQDKFLANVYL---PTSAELTA-SEAKIEQFEGTLKFDGIVSSQIYIHSRCTFAEAERF 292

  Fly   565 LTKEKLISALSREQ 578
            :..:.:.|.:||.|
  Fly   293 IVTDIVRSLMSRIQ 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_523941.2 STKc_p70S6K 81..402 CDD:270736
CG12069NP_651819.1 Protein Kinases, catalytic domain 45..335 CDD:473864 35/144 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.