DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and rps6kb1

DIOPT Version :10

Sequence 1:NP_523941.2 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_012812128.1 Gene:rps6kb1 / 394938 XenbaseID:XB-GENE-482409 Length:530 Species:Xenopus tropicalis


Alignment Length:39 Identity:11/39 - (28%)
Similarity:20/39 - (51%) Gaps:1/39 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 GKCFASAKP-VWLSDVVNSGSDYCVRSFLAKSAGIQTVV 205
            |..|.|.:. .:|||.:.:.|...|....|::.|:.|::
 Frog    21 GNTFQSFRDHSFLSDKLYTASPNLVNGLQARTFGVWTLL 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_523941.2 STKc_p70S6K 81..402 CDD:270736 11/39 (28%)
rps6kb1XP_012812128.1 STKc_p70S6K 99..421 CDD:270736
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.