DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and Stk32a

DIOPT Version :9

Sequence 1:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001178823.1 Gene:Stk32a / 364858 RGDID:1308338 Length:397 Species:Rattus norvegicus


Alignment Length:349 Identity:108/349 - (30%)
Similarity:180/349 - (51%) Gaps:40/349 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 FELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFI 141
            ||:.:.:|||.:|||..|:|   .|..|.:|||.:.|...| .:.:..:...|..|::.::|||:
  Rat    23 FEILRAIGKGSFGKVCIVQK---NDTKKMYAMKYMNKQKCV-ERNEVRNVFKELQIMQGLEHPFL 83

  Fly   142 VELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLK 206
            |.|.|:||.:..::::::.|.||:|..||::...|.|||...::.|:.:||.:|....||:||:|
  Rat    84 VNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFQEDTVKLFICELAMALDYLQSQRIIHRDMK 148

  Fly   207 PENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILT---RSGHGKAVDWWSLGAL 268
            |:|||||..|||.:|||.:.....:|..:| |..||..|||||:.:   .||:..||||||||..
  Rat   149 PDNILLDEHGHVHITDFNIAAMLPKETRIT-TVAGTKPYMAPEMFSSRKESGYSFAVDWWSLGVT 212

  Fly   269 MFDMLTGVPPF---TAENRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAA 330
            .:::|.|..|:   ::.:.|:.:.....|.:..|:..:.|...|:::|::....||.    ....
  Rat   213 AYELLRGRRPYHIRSSTSSKEIVNMFETAIVTYPSAWSAEMVSLLKKLLEPNPDQRF----SHLT 273

  Fly   331 AVQIHPFFKHVNWDDVLARRLEPPI----------------------KPLLRSEDDVSQFDTRFT 373
            .:|..|:...:|||.||.:||.|..                      |||.:.:..:::.:....
  Rat   274 DIQNFPYMSDMNWDAVLQKRLIPGFVPTKGRLNCDPTFELEEMILESKPLHKKKKRLAKKEKEMK 338

  Fly   374 RQIPVDSPDDTTLSESANLIFQGF 397
            :   .|||....|.|..:.:.:.|
  Rat   339 K---CDSPQMCLLQEHLDAVQKEF 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 107/347 (31%)
STKc_p70S6K 81..402 CDD:270736 106/345 (31%)
Stk32aNP_001178823.1 STKc_Yank1 22..281 CDD:270730 91/266 (34%)
S_TKc 23..270 CDD:214567 89/255 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.