DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and rps6ka3a

DIOPT Version :9

Sequence 1:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_005165175.1 Gene:rps6ka3a / 338219 ZFINID:ZDB-GENE-030219-119 Length:733 Species:Danio rerio


Alignment Length:428 Identity:196/428 - (45%)
Similarity:270/428 - (63%) Gaps:40/428 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADVSDPSELFDLELHDLELQDDKARDSDDDRIELDDVDLEPELCINLHQDTEGQETIQLCEENV 65
            :|..:||.:  .|.:..||.:||..  .:||.:..|:..:: |:.|..|               |
Zfish     3 LAQCADPWQ--KLPMGHLENEDDSM--IEDDSLVHDEGSVK-EISITHH---------------V 47

  Fly    66 NPGKIKLGPKDFELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAER 130
            ..|..|..|:.|||:||||:|.:||||.|:|.:|.||.:.:||||||||::  ..:|...|:.||
Zfish    48 KEGSEKADPRQFELRKVLGQGSFGKVFLVKKISGPDAGQLYAMKVLKKATL--KVRDRVRTKMER 110

  Fly   131 NILEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHL 195
            :||..|.|||||:|.|||||:|||||||::|.||:||..|.:|.:|.|:...|||:|:.|||.||
Zfish   111 DILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHL 175

  Fly   196 HKLGIIYRDLKPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAV 260
            |.||||||||||||||||..||:|||||||.||.|......::||||:||||||::.|.||.::.
Zfish   176 HGLGIIYRDLKPENILLDDDGHIKLTDFGLSKESIDHENKAYSFCGTVEYMAPEVVNRRGHTQSA 240

  Fly   261 DWWSLGALMFDMLTGVPPFTAENRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSG 325
            ||||.|.|||:||||..||..::||:|:..||||||.:|.:|:|||:.|:|.|.||....|||:|
Zfish   241 DWWSYGVLMFEMLTGALPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLRNLFKRNPGNRLGAG 305

  Fly   326 PEDAAAVQIHPFFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIPVDSPDDTTLSESA 390
            |:....::.|.||..::|:.:..:.:.||.||.::..||...||:.||.:.|.||| ....|.:|
Zfish   306 PDGVEGIKRHSFFTRIDWNKLFRKEVPPPFKPAIKKPDDTFYFDSEFTAKTPRDSP-GVPPSANA 369

  Fly   391 NLIFQGFTYVA-----------------PSILEDMHRA 411
            :.:|:||::||                 .|||:..||:
Zfish   370 HQLFRGFSFVATGVEEESQSPIQSNINMSSILQQSHRS 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 169/320 (53%)
STKc_p70S6K 81..402 CDD:270736 170/337 (50%)
rps6ka3aXP_005165175.1 S_TKc 59..318 CDD:214567 149/260 (57%)
STKc_RSK_N 63..379 CDD:270734 168/318 (53%)
STKc_RSK2_C 395..733 CDD:271078 5/13 (38%)
Pkinase 415..672 CDD:278497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573224
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1132245at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.