DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and rps6kal

DIOPT Version :9

Sequence 1:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_956367.1 Gene:rps6kal / 337670 ZFINID:ZDB-GENE-030131-9616 Length:740 Species:Danio rerio


Alignment Length:413 Identity:194/413 - (46%)
Similarity:262/413 - (63%) Gaps:23/413 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RIELDDVDLEPELCINLHQ---DTEGQETIQLCEE----------NVNPGKIKLGPKDFELKKVL 83
            ::|:..|..|    :|.||   :...:|:...|:|          :|..|..|..|..|||.|||
Zfish    13 KMEVQSVSSE----VNGHQIMDEPMEEESYTHCDEGAYKEIPITHHVKEGCEKADPSQFELLKVL 73

  Fly    84 GKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFIVELVYAF 148
            |:|.:||||.|||..|.||.:.:|||||||||:  ..:|...|:.||:||..|.|||||:|.|||
Zfish    74 GQGSFGKVFLVRKLMGPDAGQLYAMKVLKKASL--KVRDRVRTKMERDILVEVNHPFIVKLHYAF 136

  Fly   149 QTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLD 213
            ||:|||||||::|.||::|..|.:|.:|.|:...|||:|:.|||.|||.|||:||||||||||||
Zfish   137 QTEGKLYLILDFLRGGDVFTRLSKEVMFTEEDVKFYLAELALALDHLHNLGIVYRDLKPENILLD 201

  Fly   214 AQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMFDMLTGVPP 278
            ..||:|||||||.||.:.:....::||||:||||||::.|.||.::.||||||.|||:||||..|
Zfish   202 EAGHIKLTDFGLSKESVDQDKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSLGVLMFEMLTGTLP 266

  Fly   279 FTAENRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKHVNW 343
            |..::|.:|:..||||||.:|.:|:.||:.|:|.|.||....|||:||:....::.|.||..::|
Zfish   267 FQGKDRNETMNMILKAKLGMPQFLSLEAQGLLRMLFKRNPSNRLGAGPDGVEEIKRHTFFSTIDW 331

  Fly   344 DDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIPVDSPDDTTLSESANLIFQGFTYVAPSILEDM 408
            :.:..|.|:||.||.....||...||..||.:.|.||| ....|.:|:.:|:||::|||..||:.
Zfish   332 NKLYRRELQPPFKPASGKPDDTFCFDPEFTAKTPKDSP-GIPPSANAHQLFKGFSFVAPVSLEES 395

  Fly   409 HRA---NRMPARSPRRTPRQLPD 428
            ..|   |.:|......:..|..|
Zfish   396 KSAPLVNILPIVQVHGSSAQFSD 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 169/320 (53%)
STKc_p70S6K 81..402 CDD:270736 169/320 (53%)
rps6kalNP_956367.1 S_TKc 67..326 CDD:214567 147/260 (57%)
STKc_RSK_N 71..387 CDD:270734 168/318 (53%)
STKc_RSK4_C 415..709 CDD:271079 2/4 (50%)
S_TKc 420..677 CDD:214567
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573226
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1132245at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.