DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and sgk1

DIOPT Version :9

Sequence 1:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_005162356.1 Gene:sgk1 / 324140 ZFINID:ZDB-GENE-030131-2860 Length:598 Species:Danio rerio


Alignment Length:386 Identity:169/386 - (43%)
Similarity:240/386 - (62%) Gaps:33/386 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EPELCINLHQDTEGQETIQLCEENVNP-----GKIKLG--------PKDFELKKVLGKGGYGKVF 92
            |.:..:||   |..|: ::|...|.:|     .:|.||        |.||:..||:|||.:|||.
Zfish   220 EVQSILNL---TPPQD-VELMNSNPSPPPSPSQQINLGPSSNPTAKPSDFDFLKVIGKGSFGKVL 280

  Fly    93 QVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNI-LEAVKHPFIVELVYAFQTDGKLYL 156
            ..|.   |...|::|:|||:|.:|: .:|:..|..:|||: |:.|||||:|.|.|:|||..|||.
Zfish   281 LARH---RSDEKFYAVKVLQKKAIL-KKKEEKHIMSERNVLLKNVKHPFLVGLHYSFQTTDKLYF 341

  Fly   157 ILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKLT 221
            :|:|::|||||.||:||..|||....||.:||..|||:||.|.|:||||||||||||:|||:.||
Zfish   342 VLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIILT 406

  Fly   222 DFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMFDMLTGVPPFTAENRKK 286
            |||||||:|:....|.|||||.||:|||:|.:..:.:.||||.|||::::||.|:|||.:.|..:
Zfish   407 DFGLCKENIEPNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAE 471

  Fly   287 TIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLARRL 351
            ..:.||...|.|...::..||.|:..|:::...:|||. .:|...::.|.||..:||||:.|::|
Zfish   472 MYDNILNKPLQLKPNISNAARHLLEGLLQKDRTKRLGF-TDDFTEIKNHMFFSPINWDDLNAKKL 535

  Fly   352 EPPIKPLLRSEDDVSQFDTRFTRQIPVD-----SPDDTTLSES---ANLIFQGFTYVAPSI 404
            .||..|.:...:|:..||..||.: ||.     |||...::.|   |...|.||:| ||::
Zfish   536 TPPFNPNVTGPNDLRHFDPEFTDE-PVPNSIGCSPDSALVTSSITEATEAFLGFSY-APAM 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 152/329 (46%)
STKc_p70S6K 81..402 CDD:270736 153/329 (47%)
sgk1XP_005162356.1 STKc_SGK1 257..595 CDD:270753 158/345 (46%)
S_TKc 265..522 CDD:214567 127/261 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.