DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and STK32C

DIOPT Version :9

Sequence 1:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_011537990.1 Gene:STK32C / 282974 HGNCID:21332 Length:504 Species:Homo sapiens


Alignment Length:460 Identity:130/460 - (28%)
Similarity:208/460 - (45%) Gaps:67/460 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LEPELCINLHQDTEGQETIQLCEENVNPGKIKLGPKD--------------FELKKVLGKGGYGK 90
            |.|.|...|  ...|.:|     ::|..|:::| |.|              |::.:.:|||.:||
Human    63 LSPNLASGL--AARGTQT-----QSVLFGEVRL-PLDGGVRGARKRMNFDHFQILRAIGKGSFGK 119

  Fly    91 --VFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFIVELVYAFQTDGK 153
              ..||.....||..|.:|||.:.|...: .:.:..:...|..||:.::|.|:|.|.|:||.:..
Human   120 PCALQVCIVQKRDTEKMYAMKYMNKQQCI-ERDEVRNVFRELEILQEIEHVFLVNLWYSFQDEED 183

  Fly   154 LYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHV 218
            ::::::.|.||:|..||::...|.|||...|:.|:.|||.:|....||:||:||:|||||.:||.
Human   184 MFMVVDLLLGGDLRYHLQQNVQFSEDTVRLYICEMALALDYLRGQHIIHRDVKPDNILLDERGHA 248

  Fly   219 KLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTR-----SGHGKAVDWWSLGALMFDMLTGVPP 278
            .||||.:. ..|::|.......||..||||||...     :|:...|||||:|.:.:::|.|..|
Human   249 HLTDFNIA-TIIKDGERATALAGTKPYMAPEIFHSFVNGGTGYSFEVDWWSVGVMAYELLRGWRP 312

  Fly   279 FTAENRKKTIETILKAKLNLPAYLTP----EARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFK 339
            :...: ...:|::::....:.....|    |...|:|:|:......||.|..:    ||..|...
Human   313 YDIHS-SNAVESLVQLFSTVSVQYVPTWSKEMVALLRKLLTVNPEHRLSSLQD----VQAAPALA 372

  Fly   340 HVNWDDVLARRLEPPIKP---------------LLRSEDDVSQFDTRFTRQIPVDSPDDTTLSES 389
            .|.||.:..:|:||...|               ::.....:.:...|..:....|:..|::.||:
Human   373 GVLWDHLSEKRVEPGFVPNKGRLHCDPTFELEEMILESRPLHKKKKRLAKNKSRDNSRDSSQSEN 437

  Fly   390 ANL------IFQGFTYVAPSIL---EDMHRANRMPARSPRRTPRQLPDSSFRLQFPSANVGANAP 445
            ..|      |.|.|.......|   :|:.| ..:||...|.....:.|.:.|...|..  |...|
Human   438 DYLQDCLDAIQQDFVIFNREKLKRSQDLPR-EPLPAPESRDAAEPVEDEAERSALPMC--GPICP 499

  Fly   446 LAMHG 450
            .|..|
Human   500 SAGSG 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 106/366 (29%)
STKc_p70S6K 81..402 CDD:270736 105/352 (30%)
STK32CXP_011537990.1 STKc_Yank1 105..371 CDD:270730 90/272 (33%)
S_TKc 106..366 CDD:214567 87/266 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.