DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and RPS6KA6

DIOPT Version :9

Sequence 1:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_016884912.1 Gene:RPS6KA6 / 27330 HGNCID:10435 Length:762 Species:Homo sapiens


Alignment Length:419 Identity:192/419 - (45%)
Similarity:266/419 - (63%) Gaps:28/419 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVSDPSEL-FDLELHDLELQDDKARDSDDDRIELDDVDLEPELCINLHQDTEGQETIQLCEENVN 66
            ::.:|.|: ..::::.|::.|:...:.:.|  ...|..:..|:.|. |...||.|          
Human    32 EIVNPYEVKRKVKVNGLKMVDEPMEEGEAD--SCHDEGVVKEIPIT-HHVKEGYE---------- 83

  Fly    67 PGKIKLGPKDFELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERN 131
                |..|..|||.||||:|.:||||.|||..|.||.:.:|||||||||:  ..:|...|:.||:
Human    84 ----KADPAQFELLKVLGQGSFGKVFLVRKKTGPDAGQLYAMKVLKKASL--KVRDRVRTKMERD 142

  Fly   132 ILEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLH 196
            ||..|.|||||:|.|||||:|||||||::|.||::|..|.:|.:|.|:...|||:|:.|||.|||
Human   143 ILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVLFTEEDVKFYLAELALALDHLH 207

  Fly   197 KLGIIYRDLKPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVD 261
            :|||:||||||||||||..||:|||||||.||.:.:....::||||:||||||::.|.||.::.|
Human   208 QLGIVYRDLKPENILLDEIGHIKLTDFGLSKESVDQEKKAYSFCGTVEYMAPEVVNRRGHSQSAD 272

  Fly   262 WWSLGALMFDMLTGVPPFTAENRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGP 326
            |||.|.|||:||||..||..::|.:|:..||||||.:|.:|:.||:.|:|.|.||....||||  
Human   273 WWSYGVLMFEMLTGTLPFQGKDRNETMNMILKAKLGMPQFLSAEAQSLLRMLFKRNPANRLGS-- 335

  Fly   327 EDAAAVQIHPFFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIPVDSPDDTTLSESAN 391
            |....::.|.||.:::||.:..|.::||.||.....||...||..||.:.|.||| ....|.:|:
Human   336 EGVEEIKRHLFFANIDWDKLYKREVQPPFKPASGKPDDTFCFDPEFTAKTPKDSP-GLPASANAH 399

  Fly   392 LIFQGFTYVAPSILED-----MHRANRMP 415
            .:|:||::||.||.|:     :..||.:|
Human   400 QLFKGFSFVATSIAEEYKITPITSANVLP 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 168/320 (53%)
STKc_p70S6K 81..402 CDD:270736 168/320 (53%)
RPS6KA6XP_016884912.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1132245at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.