DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and Akt2

DIOPT Version :9

Sequence 1:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_008757330.1 Gene:Akt2 / 25233 RGDID:2082 Length:496 Species:Rattus norvegicus


Alignment Length:399 Identity:166/399 - (41%)
Similarity:238/399 - (59%) Gaps:27/399 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DSDDDRIE-LDDVDLEPELCINLHQDTEGQE-------------TIQLCEENVNPGKIKLGPKDF 77
            ||.|:|.| :..:.:   :..:|.|...|::             |.::.|..|:..:.|:...||
  Rat   106 DSPDEREEWIRAIQM---VANSLKQRGPGEDAMDYKCGSPSDSSTSEMMEVAVSKARAKVTMNDF 167

  Fly    78 ELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFIV 142
            :..|:||||.:|||..||:.|   ..:|:|||:|:|..|:. :.:.|||..|..:|:..:|||:.
  Rat   168 DYLKLLGKGTFGKVILVREKA---TGRYYAMKILRKEVIIA-KDEVAHTVTESRVLQNTRHPFLT 228

  Fly   143 ELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKP 207
            .|.|||||..:|..::||.:|||||.||.||.:|.||...||.:||:.||.:||...::|||:|.
  Rat   229 ALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKL 293

  Fly   208 ENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMFDM 272
            ||::||..||:|:||||||||.|.:|....|||||.||:|||:|..:.:|:|||||.||.:|::|
  Rat   294 ENLMLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEM 358

  Fly   273 LTGVPPFTAENRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPF 337
            :.|..||..::.::..|.||..::..|..|.|||:.|:..|:|:...||||.||.||..|..|.|
  Rat   359 MCGRLPFYNQDHERLFELILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRF 423

  Fly   338 FKHVNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQ-IPVDSPD--DT--TLSESANLIFQGF 397
            |..:||.||:.::|.||.||.:.||.|...||..||.| |.:..||  |:  :|.......|..|
  Rat   424 FLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQF 488

  Fly   398 TYVAPSILE 406
            :|.| ||.|
  Rat   489 SYSA-SIRE 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 148/325 (46%)
STKc_p70S6K 81..402 CDD:270736 148/325 (46%)
Akt2XP_008757330.1 PH_PKB 32..126 CDD:269947 5/22 (23%)
PH 35..121 CDD:278594 5/17 (29%)
S_TKc 167..424 CDD:214567 122/260 (47%)
STKc_PKB_beta 171..493 CDD:173686 149/326 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.