DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and Akt3

DIOPT Version :9

Sequence 1:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_035915.3 Gene:Akt3 / 23797 MGIID:1345147 Length:479 Species:Mus musculus


Alignment Length:333 Identity:150/333 - (45%)
Similarity:208/333 - (62%) Gaps:11/333 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 DFELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPF 140
            ||:..|:||||.:|||..||:.|   :.||:|||:|||..|:. :.:.|||..|..:|:..:|||
Mouse   147 DFDYLKLLGKGTFGKVILVREKA---SGKYYAMKILKKEVIIA-KDEVAHTLTESRVLKNTRHPF 207

  Fly   141 IVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDL 205
            :..|.|:|||..:|..::||::|||||.||.||.:|.||.|.||.:||:.||.:||...|:||||
Mouse   208 LTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDL 272

  Fly   206 KPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMF 270
            |.||::||..||:|:||||||||.|.:.....|||||.||:|||:|..:.:|:|||||.||.:|:
Mouse   273 KLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMY 337

  Fly   271 DMLTGVPPFTAENRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIH 335
            :|:.|..||..::.:|..|.||...:..|..|:.:|:.|:..|:.:...:|||.||:||..:..|
Mouse   338 EMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRH 402

  Fly   336 PFFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQ----IPVDSPDDTTLSESAN---LI 393
            .||..|||.||..::|.||.||.:.||.|...||..||.|    .|.:..||..:....|   ..
Mouse   403 SFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDDDGMDGMDNERRPH 467

  Fly   394 FQGFTYVA 401
            |..|:|.|
Mouse   468 FPQFSYSA 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 147/327 (45%)
STKc_p70S6K 81..402 CDD:270736 148/328 (45%)
Akt3NP_035915.3 PH_PKB 4..110 CDD:269947
STKc_PKB_gamma 132..479 CDD:270745 150/333 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 445..479 8/31 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.