DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6k and SGK3

DIOPT Version :9

Sequence 1:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001028750.1 Gene:SGK3 / 23678 HGNCID:10812 Length:496 Species:Homo sapiens


Alignment Length:371 Identity:160/371 - (43%)
Similarity:230/371 - (61%) Gaps:20/371 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QDTEGQETIQLCEENVN---PGKIKLGPKDFELKKVLGKGGYGKVFQV-RKTAGRDANKYFAMKV 110
            :|....:.:....:|:|   .|.....|.||:..||:|||.:|||... ||..|    |::|:||
Human   132 EDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDG----KFYAVKV 192

  Fly   111 LKKASIVTNQKDTAHTRAERNI-LEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREG 174
            |:| .||.|:|:..|..||||: |:.|||||:|.|.|:|||..|||.:|::::|||||.||:||.
Human   193 LQK-KIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRER 256

  Fly   175 IFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTF 239
            .|.|....||.:||..|||:||.:.|:||||||||||||:.|||.|||||||||.|.....|.||
Human   257 SFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTF 321

  Fly   240 CGTIEYMAPEILTRSGHGKAVDWWSLGALMFDMLTGVPPFTAENRKKTIETILKAKLNLPAYLTP 304
            |||.||:|||::.:..:...||||.|||::::||.|:|||...:..:..:.||...|:|...::.
Human   322 CGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSL 386

  Fly   305 EARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFD 369
            .|..::..|:::....|||: .||...:|.||||:.::|.|::.:::.||..|.:...||:..||
Human   387 TAWSILEELLEKDRQNRLGA-KEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFD 450

  Fly   370 TRFTRQ-IPVD---SPDDTTLSES---ANLIFQGFTYVAPSILEDM 408
            |.||.: :|..   |.|.:.::.|   |:..|.||:|..||  ||:
Human   451 TAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPS--EDL 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 148/329 (45%)
STKc_p70S6K 81..402 CDD:270736 149/329 (45%)
SGK3NP_001028750.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PX_CISK 12..120 CDD:132780
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..156 4/23 (17%)
STKc_SGK3 165..490 CDD:270755 149/330 (45%)
Nuclear localization signal. /evidence=ECO:0000250 195..205 5/10 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.