DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bre1 and PEX10

DIOPT Version :9

Sequence 1:NP_001286950.1 Gene:Bre1 / 38652 FlyBaseID:FBgn0086694 Length:1044 Species:Drosophila melanogaster
Sequence 2:NP_010551.1 Gene:PEX10 / 851858 SGDID:S000002673 Length:337 Species:Saccharomyces cerevisiae


Alignment Length:201 Identity:40/201 - (19%)
Similarity:71/201 - (35%) Gaps:67/201 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   893 LRQQAMEMHKRKAIESAQSAAD---------LKLH---------------------------LEK 921
            |.::.|:.:|...||..:|.|.         |.:|                           |.|
Yeast   126 LYKKIMKNNKESKIEDTESVAAFCKGLLDFILDVHMTLFYFKGAFYSISKRIFGMRYVFKHILSK 190

  Fly   922 YHAQMKE--------------AQQVV---AEKTSSLEAEAYKTKRLQEELAQ----FKRKAER-- 963
            ..|..:|              ||.|:   ...||:|.:..|..||..:.:.:    .:.::|.  
Yeast   191 NEANFREEGSQKYKVLGYILLAQNVMKWYPVLTSTLGSWIYGRKRTNDSITRSSVGLQERSEHES 255

  Fly   964 ----MKKMEMSGTTI-DEVMIEEIREYKETLTCPSCKVKRKDAVLSKCFHVFCYDCLRTRYETRQ 1023
                .|:.:::...: |:..:..|.|  .:..|..|.:...|...:.|.|:||:.||.:..:.|.
Yeast   256 IEGIPKESQLTHINLSDKNQLPFIPE--ASRKCILCLMNMSDPSCAPCGHLFCWSCLMSWCKERP 318

  Fly  1024 RKCPKC 1029
             :||.|
Yeast   319 -ECPLC 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bre1NP_001286950.1 SMC_prok_B <235..987 CDD:274008 27/157 (17%)
AAA_23 <654..762 CDD:290211
zf-C3HC4_2 991..1029 CDD:290634 12/37 (32%)
PEX10NP_010551.1 PEX10 5..337 CDD:227861 40/201 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.