DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bre1 and Trim39

DIOPT Version :9

Sequence 1:NP_001286950.1 Gene:Bre1 / 38652 FlyBaseID:FBgn0086694 Length:1044 Species:Drosophila melanogaster
Sequence 2:NP_001361535.1 Gene:Trim39 / 79263 MGIID:1890659 Length:496 Species:Mus musculus


Alignment Length:290 Identity:62/290 - (21%)
Similarity:113/290 - (38%) Gaps:95/290 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 ALEETLKQTHIEIMSENHKLQNLNTSLHEKFHTMSLKMKEYQDA-------------HTAKETEN 269
            ::.|..||  ::.:....:.::|.:..||   .:||...|.|:|             ||....::
Mouse    86 SMVEIAKQ--LQTVKRKIRDESLCSQHHE---PLSLFCYEDQEAVCLICAISHTHRPHTVVPMDD 145

  Fly   270 A------ELKNQIDELQYDLEKIHCRNDKLENHLAEAIEKLKAYHQIYGDPNKSTNSAKTPTTTG 328
            |      :|:..::.|:..|::|.|         .:|.|:.|.     |:..:...|.:      
Mouse   146 ATQEYKEKLQKCLEPLEQKLQEITC---------CKASEEKKP-----GELKRLVESRR------ 190

  Fly   329 SGGATTSVNSQLL---EELQKELEEYRELANNRLQE-----LDKLHATHRETLKEVEKLKMDIRQ 385
                     .|:|   |||.:.|:|.::...:||:|     |.:|    ||....:...:.|:..
Mouse   191 ---------QQILKEFEELHRRLDEEQQTLLSRLEEEEQDILQRL----RENAAHLGDRRRDLAH 242

  Fly   386 LPESVIVETTEYKCLQSQFSVLYNESMQIKTMLDETRNQLQTSKNQHLRQIEVMESEELIAQKKV 450
            |...|     |.|||||.|.:|    ..:|:.|::            ..:::.||         |
Mouse   243 LAAEV-----EGKCLQSGFEML----KDVKSTLEK------------CEKVKTME---------V 277

  Fly   451 RSEMIQMEDVLALIRKEYETLRIEFEQNMA 480
            .|..|::|...:...::|..||...:|.:|
Mouse   278 TSVSIELEKNFSNFPRQYFALRKILKQLIA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bre1NP_001286950.1 SMC_prok_B <235..987 CDD:274008 59/273 (22%)
AAA_23 <654..762 CDD:290211
zf-C3HC4_2 991..1029 CDD:290634
Trim39NP_001361535.1 RING-HC_TRIM39_C-IV 26..69 CDD:319515
Bbox2_TRIM39-like 103..146 CDD:380838 10/45 (22%)
PRK02224 <144..>294 CDD:179385 44/212 (21%)
SPRY_PRY_TRIM39 314..491 CDD:293979
Interaction with CDKN1A. /evidence=ECO:0000250|UniProtKB:Q9HCM9 367..496
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.