DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bre1 and PEX10

DIOPT Version :9

Sequence 1:NP_001286950.1 Gene:Bre1 / 38652 FlyBaseID:FBgn0086694 Length:1044 Species:Drosophila melanogaster
Sequence 2:NP_722540.1 Gene:PEX10 / 5192 HGNCID:8851 Length:346 Species:Homo sapiens


Alignment Length:402 Identity:83/402 - (20%)
Similarity:130/402 - (32%) Gaps:148/402 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   676 AQLKKALNDQKEMKLLLDM-YKG--------------VSKDQRDKVQLMATEKKLRSEIEELRQQ 725
            |..:|.|..:||::||.|: |.|              ||..|.|..::.......|..:..|...
Human    37 AGARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVTLHAV 101

  Fly   726 LKKLQESKREERKKLADEEALRKIKQLEEQKYELQKQMANHKPTDNSWGSGAPGTANYTRPFVGS 790
            |..|.            ::||..::|      |||....:.:|...|.|.|..|.:. .|.::..
Human   102 LPYLL------------DKALLPLEQ------ELQADPDSGRPLQGSLGPGGRGCSG-ARRWMRH 147

  Fly   791 H-------EEEALLNEMEVTGQAFEDMQEQN--------------SRL----IQQLREKDDANFK 830
            |       :..|||..:.|..|....:|..:              .||    .|.||  .|....
Human   148 HTATLTEQQRRALLRAVFVLRQGLACLQRLHVAWFYIHGVFYHLAKRLTGITYQALR--PDPLRV 210

  Fly   831 LMSERIKANQLHKLLREEKTVLEDQMATATTQ----IEAMHIVLRKLEEKERSLQATVASIEKEL 891
            |||....|.|    ||......||..|..:.:    |..:|:||        |:...:....:  
Human   211 LMSVAPSALQ----LRVRSLPGEDLRARVSYRLLGVISLLHLVL--------SMGLQLYGFRQ-- 261

  Fly   892 MLRQQAMEMHKRKAIESAQSAADLKLHLEKYHAQMKEAQQVVAEKTSSLEAEAYKTKRLQEELAQ 956
              ||:|     ||         :.:||            :.::.:.:|||..|.....|      
Human   262 --RQRA-----RK---------EWRLH------------RGLSHRRASLEERAVSRNPL------ 292

  Fly   957 FKRKAERMKKMEMSGTTIDEVMIEEIREYKETLTCPSCKVKRKDAVLSKCFHVFCYDCLRTRYET 1021
                                              |..|..:|:....:.|.|:||::|: |.:.:
Human   293 ----------------------------------CTLCLEERRHPTATPCGHLFCWECI-TAWCS 322

  Fly  1022 RQRKCPKCNCAF 1033
            .:.:||.|...|
Human   323 SKAECPLCREKF 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bre1NP_001286950.1 SMC_prok_B <235..987 CDD:274008 70/354 (20%)
AAA_23 <654..762 CDD:290211 24/100 (24%)
zf-C3HC4_2 991..1029 CDD:290634 11/37 (30%)
PEX10NP_722540.1 Pex2_Pex12 18..263 CDD:282595 58/262 (22%)
RING 293..334 CDD:238093 12/41 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.