DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bre1 and dgrn

DIOPT Version :9

Sequence 1:NP_001286950.1 Gene:Bre1 / 38652 FlyBaseID:FBgn0086694 Length:1044 Species:Drosophila melanogaster
Sequence 2:NP_649596.1 Gene:dgrn / 40725 FlyBaseID:FBgn0037384 Length:319 Species:Drosophila melanogaster


Alignment Length:335 Identity:68/335 - (20%)
Similarity:108/335 - (32%) Gaps:130/335 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   814 NSRLIQQLREKDDANFKLMSER-------------IKANQLHKLLREEKTVLEDQMATATTQIEA 865
            ||.::.|   ..|:|....|..             |::|..|      .|.:|.|.:..:.....
  Fly    10 NSSILDQ---SADSNVSSSSSNSSVSDSSVDSHSSIESNSGH------NTSVESQSSAESDSSAD 65

  Fly   866 MHIVLRKLEEKERSLQATVASIEKELMLRQQAMEMHKRKA---IESAQS-----AADLKLHLEKY 922
            .|..|.:....||.|     |:|.:........|....:|   ::|.||     .|:|.:..|..
  Fly    66 SHSSLERPSPVERDL-----SVESDSSSATNTSESSVGEASNQLQSPQSNNPLNMANLSVSTEDA 125

  Fly   923 HAQMKEAQQVVAEKTSSLEAEAYKTKRLQEELA----------------QFKRKAERMKKMEMS- 970
            |:|::...|.|.:    :|||..:..|..||:.                :.:|:...::.:::| 
  Fly   126 HSQIRSLTQDVIQ----MEAELDRMNRYCEEVVAQIDTFATRTSTPTTRRIRRRTSPVEVIDLSH 186

  Fly   971 ----------------------------------------------------------------- 970
                                                                             
  Fly   187 LDRAPPVRSARNRDPDAFIDLCTPEGPRSRTVNLHSNDSLTILPRRSAENDPVVDLDVASPPKRV 251

  Fly   971 GTTIDEVMIEEIREYKETLTCPSC--KVKRKDAVLSKCFHVFCYDCLRTRYETRQRKCPKCNCAF 1033
            ...|||...||:  ||    ||.|  .|.:::.|.:||.||||.:|:.|.... ..|||.||...
  Fly   252 NRDIDESQKEEL--YK----CPICMDSVSKREPVSTKCGHVFCRECIETAIRA-THKCPICNKKL 309

  Fly  1034 GANDYHRLYL 1043
            .|..:.|:||
  Fly   310 TARQFFRIYL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bre1NP_001286950.1 SMC_prok_B <235..987 CDD:274008 45/275 (16%)
AAA_23 <654..762 CDD:290211
zf-C3HC4_2 991..1029 CDD:290634 16/39 (41%)
dgrnNP_649596.1 RING 266..305 CDD:214546 16/39 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.