powered by:
Protein Alignment Bre1 and rnf185
DIOPT Version :9
Sequence 1: | NP_001286950.1 |
Gene: | Bre1 / 38652 |
FlyBaseID: | FBgn0086694 |
Length: | 1044 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_998202.1 |
Gene: | rnf185 / 406310 |
ZFINID: | ZDB-GENE-040426-1977 |
Length: | 194 |
Species: | Danio rerio |
Alignment Length: | 57 |
Identity: | 22/57 - (38%) |
Similarity: | 27/57 - (47%) |
Gaps: | 2/57 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 988 TLTCPSCKVKRKDAVLSKCFHVFCYDCLRTRYETRQRK--CPKCNCAFGANDYHRLY 1042
|..|..|....||||:|.|.|:||:.||....|||..: ||.|......:....||
Zfish 38 TFECNICLDTSKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLY 94
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R146 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.