DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Bre1 and rnf185

DIOPT Version :9

Sequence 1:	NP_001286950.1	Gene:	Bre1 / 38652	FlyBaseID:	FBgn0086694	Length:	1044	Species:	Drosophila melanogaster
Sequence 2:	NP_998202.1	Gene:	rnf185 / 406310	ZFINID:	ZDB-GENE-040426-1977	Length:	194	Species:	Danio rerio

Alignment Length:	57	Identity:	22/57 - (38%)
Similarity:	27/57 - (47%)	Gaps:	2/57 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   988 TLTCPSCKVKRKDAVLSKCFHVFCYDCLRTRYETRQRK--CPKCNCAFGANDYHRLY 1042
            |..|..|....||||:|.|.|:||:.||....|||..:  ||.|......:....||
Zfish    38 TFECNICLDTSKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLY 94

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Bre1	NP_001286950.1	SMC_prok_B	<235..987	CDD:274008
		AAA_23	<654..762	CDD:290211
		zf-C3HC4_2	991..1029	CDD:290634	18/39 (46%)
rnf185	NP_998202.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..32
		Required for ubiquitin ligase activity and protection against ER stress-induced cell death. /evidence=ECO:0000250\|UniProtKB:Q96GF1	31..82		19/43 (44%)
		RING	40..85	CDD:238093	19/44 (43%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	92..126		2/3 (67%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R146
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.030