DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bre1 and Pex10

DIOPT Version :9

Sequence 1:NP_001286950.1 Gene:Bre1 / 38652 FlyBaseID:FBgn0086694 Length:1044 Species:Drosophila melanogaster
Sequence 2:NP_001261265.1 Gene:Pex10 / 38182 FlyBaseID:FBgn0035233 Length:299 Species:Drosophila melanogaster


Alignment Length:277 Identity:55/277 - (19%)
Similarity:107/277 - (38%) Gaps:70/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 EQNSRLIQQLREKDDANFKLMSER--IKANQLHKLLRE-----------EKTVLEDQMATATTQI 863
            ::::|...:|.|......:|...|  ||.||:.:||.|           .:|:.|:.  |...|:
  Fly    18 QKDARYTNELAEDLSDVLRLTGPRNWIKYNQMCRLLAELSYHGFASANNLQTLGEEY--TGIIQV 80

  Fly   864 EAMHIVLRKLEEKERSLQATVASIEKELMLRQQAMEMHKRKAIESAQSAADLKLHLEKYHAQMKE 928
            :..:   :::..:...|.|.|.....: .|.|:.|:........:.:...::|..|:|...::::
  Fly    81 DGNY---KQIPSRLLQLIAIVLEFGGD-SLFQRLMQKLDTYVANNDEIRTEIKPQLKKIIQRLRQ 141

  Fly   929 AQQVVAEKTSS---LEAEAYK-TKR------------LQEELAQF-------------------- 957
            :...|.....|   |:|..|: :||            ||.|.:.:                    
  Fly   142 SPSYVKALHKSLFYLDASKYQLSKRTTGINYVLIRHWLQPEFSLYGYKILGVITFLQVSVSLAIS 206

  Fly   958 ------KRKAERMKKMEMSGTTIDEVMIEEIREYKE----TLTCPSCKVKRKDAVLSKCFHVFCY 1012
                  :.|.::::.::.:|..    .::.....|:    |..|..|...|.|:.|:.|.|:||:
  Fly   207 GWDAWREHKRQQLESIKQAGKN----FLQRSSSTKDVDPNTPQCILCLEPRSDSSLTPCGHIFCW 267

  Fly  1013 DCLRTRYETRQRKCPKC 1029
            .||....|.|. :||.|
  Fly   268 SCLLEWLEERD-ECPLC 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bre1NP_001286950.1 SMC_prok_B <235..987 CDD:274008 37/229 (16%)
AAA_23 <654..762 CDD:290211
zf-C3HC4_2 991..1029 CDD:290634 15/37 (41%)
Pex10NP_001261265.1 Pex2_Pex12 20..>173 CDD:282595 32/158 (20%)
zf-RING_2 244..284 CDD:290367 16/41 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.