DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bre1 and Y47G6A.31

DIOPT Version :9

Sequence 1:NP_001286950.1 Gene:Bre1 / 38652 FlyBaseID:FBgn0086694 Length:1044 Species:Drosophila melanogaster
Sequence 2:NP_001021767.2 Gene:Y47G6A.31 / 3565969 WormBaseID:WBGene00044436 Length:185 Species:Caenorhabditis elegans


Alignment Length:46 Identity:16/46 - (34%)
Similarity:19/46 - (41%) Gaps:6/46 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   989 LTCPSCKVKRKD-----AVLSKCFHVFCYDCLRTRYETRQRKCPKC 1029
            |.|..|.....|     .:|..|.|.|||.||....:: |..||.|
 Worm     5 LECSICFFDFDDFQHLPKLLENCGHTFCYSCLFDWLKS-QDTCPMC 49

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bre1NP_001286950.1 SMC_prok_B <235..987 CDD:274008
AAA_23 <654..762 CDD:290211
zf-C3HC4_2 991..1029 CDD:290634 14/42 (33%)
Y47G6A.31NP_001021767.2 RAD18 3..>51 CDD:227719 16/46 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.