Sequence 1: | NP_001286950.1 | Gene: | Bre1 / 38652 | FlyBaseID: | FBgn0086694 | Length: | 1044 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001291198.1 | Gene: | Rnf4 / 19822 | MGIID: | 1201691 | Length: | 194 | Species: | Mus musculus |
Alignment Length: | 178 | Identity: | 36/178 - (20%) |
---|---|---|---|
Similarity: | 60/178 - (33%) | Gaps: | 41/178 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 903 RKAIESAQSAADLKLHLEKYHAQMKEAQQVVAEKTSSLEAEAYKTKR-----LQEELAQFKRKAE 962
Fly 963 RMKKMEMSGTTI--DEVMIEEIREYKE-----------------------TLTCPSCK------V 996
Fly 997 KRKDAVLS-KCFHVFCYDCLRTRYETRQRKCPKCNCAFGANDYHRLYL 1043 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R146 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |