DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and SEC14L5

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_055507.1 Gene:SEC14L5 / 9717 HGNCID:29032 Length:696 Species:Homo sapiens


Alignment Length:351 Identity:74/351 - (21%)
Similarity:128/351 - (36%) Gaps:93/351 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DRC------TREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAEQTLLKYLNIRRT 84
            :||      .:|..|.|||:|:  .|..:.....|..:||||||..|.:..|.:.|.:.|:.|: 
Human   232 ERCLGHLTPMQESCLIQLRHWL--QETHKGKIPKDEHILRFLRAHDFHLDKAREMLRQSLSWRK- 293

  Fly    85 FPHMSTQLDYL-----EPRLGDLIDQG------------YIFAVPQRDKHG-----------RRV 121
                ..|:|.|     .|.|.:....|            ||..:.|.|..|           |.|
Human   294 ----QHQVDLLLQTWQPPALLEEFYAGGWHYQDIDGRPLYILRLGQMDTKGLMKAVGEEALLRHV 354

  Fly   122 VVINAKGLNPKIHTSCDQAKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNP--TEFA 184
            :.:|.:| ..:...|..|......::.||:              |..|:...|:  |.|  ....
Human   355 LSVNEEG-QKRCEGSTRQLGRPISSWTCLL--------------DLEGLNMRHL--WRPGVKALL 402

  Fly   185 RIFKWGEQSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIY-GSEKE----LMKSVDQ 244
            |:.:..|.:.|.....:.::..|.....|...:...::...:.:.:|| ||..:    |:..:|:
Human   403 RMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLISPFINENTRRKFLIYSGSNYQGPGGLVDYLDR 467

  Fly   245 GCLP----------LEMGGKVPMREMIELWKQELATKRDLILGLDKSILRSDRGIQRRSSFNAGK 299
            ..:|          :..||.||....:...:||                .:|:..|...::::..
Human   468 EVIPDFLGGESVCNVPEGGLVPKSLYMTEEEQE----------------HTDQLWQWSETYHSAS 516

  Fly   300 ASTGGPNFVSQIESIEG-SFRKLEFD 324
            ...|.|:.|: :|.:|| |....:||
Human   517 VLRGAPHEVA-VEILEGESVITWDFD 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 17/46 (37%)
SEC14 101..254 CDD:238099 32/192 (17%)
SEC14L5NP_055507.1 PRELI 17..173 CDD:309720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214
CRAL_TRIO_N 243..288 CDD:215024 17/46 (37%)
SEC14 306..479 CDD:214706 33/189 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.