DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and SEC14

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_013796.1 Gene:SEC14 / 855103 SGDID:S000004684 Length:304 Species:Saccharomyces cerevisiae


Alignment Length:263 Identity:61/263 - (23%)
Similarity:111/263 - (42%) Gaps:56/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 REQSLEQLRNWVAKNEDLQNV-RCDDTFLLRFLRAKKFSVPMAEQTLLKYLNIRRTFPHMSTQLD 93
            :|::|.:||..:   ||...: |.||:.|||||||:||.|.:|::........|:.:...:...|
Yeast    33 QEKALAELRKLL---EDAGFIERLDDSTLLRFLRARKFDVQLAKEMFENCEKWRKDYGTDTILQD 94

  Fly    94 Y---LEPRLGDLIDQGYIFAVPQRDKHGRRVV-----VINAKGLNPKIHT--------------- 135
            :   .:|.:.....|.|    .:.||.||.|.     .:|...:| |:.:               
Yeast    95 FHYDEKPLIAKFYPQYY----HKTDKDGRPVYFEELGAVNLHEMN-KVTSEERMLKNLVWEYESV 154

  Fly   136 ------SCDQAKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQS- 193
                  :|.:|..|.:...|.:.|    :.|::       :::|    ::...:.|...:..|: 
Yeast   155 VQYRLPACSRAAGHLVETSCTIMD----LKGIS-------ISSA----YSVMSYVREASYISQNY 204

  Fly   194 LPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGS--EKELMKSVDQGCLPLEMGGKVP 256
            .|.|..:.::||.|..........|..:.....:::.|.||  :|||:|.:....||::.|||..
Yeast   205 YPERMGKFYIINAPFGFSTAFRLFKPFLDPVTVSKIFILGSSYQKELLKQIPAENLPVKFGGKSE 269

  Fly   257 MRE 259
            :.|
Yeast   270 VDE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 20/47 (43%)
SEC14 101..254 CDD:238099 35/181 (19%)
SEC14NP_013796.1 CRAL_TRIO_N 34..79 CDD:215024 20/47 (43%)
SEC14 99..269 CDD:214706 38/189 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.