Sequence 1: | NP_523939.1 | Gene: | Cralbp / 38651 | FlyBaseID: | FBgn0035636 | Length: | 324 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_012390.1 | Gene: | SFH5 / 853296 | SGDID: | S000003681 | Length: | 294 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 310 | Identity: | 60/310 - (19%) |
---|---|---|---|
Similarity: | 102/310 - (32%) | Gaps: | 96/310 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 LKIAKRELREDRCTREQSLEQLRNWVAKNEDLQNVRCD--------DTFLLRFLRAKKFSVPMAE 72
Fly 73 QTLLKYLNIRRTFPHMS--------TQLD----------------------YLEPRLGDLIDQGY 107
Fly 108 IFAVPQRDKHGRRVVVINAKGLNPKIHTSCDQAKAHFLTYECLMEDQETQITGLTHVGDFAGVTT 172
Fly 173 ----AHVTNWNPTEFARIFKWGEQSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLII-- 231
Fly 232 ----------------YG---SEKELMKSVDQGCLPLEMGGKVPMREMIE 262 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cralbp | NP_523939.1 | CRAL_TRIO_N | 31..78 | CDD:215024 | 9/54 (17%) |
SEC14 | 101..254 | CDD:238099 | 35/177 (20%) | ||
SFH5 | NP_012390.1 | SEC14 | 101..263 | CDD:214706 | 34/191 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1471 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |