DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and SFH5

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_012390.1 Gene:SFH5 / 853296 SGDID:S000003681 Length:294 Species:Saccharomyces cerevisiae


Alignment Length:310 Identity:60/310 - (19%)
Similarity:102/310 - (32%) Gaps:96/310 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LKIAKRELREDRCTREQSLEQLRNWVAKNEDLQNVRCD--------DTFLLRFLRAKKFSVPMAE 72
            ||.|...:.:::|.   ..::|..:....|.|.....|        |....:..:|.:|......
Yeast    15 LKKAIPGIIKEKCA---GYDELYGYKLNPEGLTQEEVDKYYDEKIADRLTYKLCKAYQFEYSTIV 76

  Fly    73 QTLLKYLNIRRTFPHMS--------TQLD----------------------YLEPRLGDLIDQGY 107
            |.|:..||.||.|..:|        |:|.                      |     |.|:.:..
Yeast    77 QNLIDILNWRREFNPLSCAYKEVHNTELQNVGILTFDANGDANKKAVTWNLY-----GQLVKKKE 136

  Fly   108 IFAVPQRDKHGRRVVVINAKGLNPKIHTSCDQAKAHFLTYECLMEDQETQITGLTHVGDFAGVTT 172
            :|  ...||..|..:.:..|||:....||.|.      .|             :|.|.|:.||:.
Yeast   137 LF--QNVDKFVRYRIGLMEKGLSLLDFTSSDN------NY-------------MTQVHDYKGVSV 180

  Fly   173 ----AHVTNWNPTEFARIFKWGEQSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLII-- 231
                :.:.|.:.|......|:..:.|..:    :.:|||:...|:.|.:|..|....:.:.::  
Yeast   181 WRMDSDIKNCSKTVIGIFQKYYPELLYAK----YFVNVPTVFGWVYDLIKKFVDETTRKKFVVLT 241

  Fly   232 ----------------YG---SEKELMKSVDQGCLPLEMGGKVPMREMIE 262
                            ||   .:..|.|.......|.|.|..:..:::||
Yeast   242 DGSKLGQYLKDCPYEGYGGKDKKNNLTKQNVTNVHPTEYGLYILQKQIIE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 9/54 (17%)
SEC14 101..254 CDD:238099 35/177 (20%)
SFH5NP_012390.1 SEC14 101..263 CDD:214706 34/191 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.