DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and Sec14l1

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_083053.2 Gene:Sec14l1 / 74136 MGIID:1921386 Length:719 Species:Mus musculus


Alignment Length:381 Identity:81/381 - (21%)
Similarity:141/381 - (37%) Gaps:91/381 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GLPEALL--KIAKRELREDRCTREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAE 72
            |.|:..|  ...||.|.:....:|..|.:||.|:  .|..:.....|..:||||||:.|::..|.
Mouse   233 GTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWL--QETHKGKIPKDEHILRFLRARDFNIDKAR 295

  Fly    73 QTLLKYLNIRRTFPHMSTQLDYL-----EPRLGDLIDQGYIFAVPQRDKHGRRVVVI-----NAK 127
            :.:.:.|..|:     ..|:||:     .|::  |:|. |.......||.||.:.|:     :.|
Mouse   296 EIMCQSLTWRK-----QHQVDYILDTWTPPQV--LLDY-YAGGWHHHDKDGRPLYVLRLGQMDTK 352

  Fly   128 GLNPKIHTSCDQAKAHF---LTYECLMEDQET------QITGLTHVGDFAGVTTAHVTNWNP--T 181
            ||   :....::|...:   :..|.|...:|.      .|:..|.:.|..|:...|:  |.|  .
Mouse   353 GL---VRALGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHL--WRPGVK 412

  Fly   182 EFARIFKWGEQSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIY-GSEKE----LMKS 241
            ...||.:..|.:.|.....:.::..|.....|...|...:....:.:.:|| |::.:    |:..
Mouse   413 ALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDY 477

  Fly   242 VDQGCLP----------LEMGGKVPM----------REMIELWKQELATKRDLILGLDKSIL--- 283
            :|:..:|          :..||.||.          .|.::||.:.:.....:..|....||   
Mouse   478 IDKEIIPDFLSGECMCDVPEGGLVPKSLYRTAEELENEDLKLWTETIYQSASVFKGAPHEILIQI 542

  Fly   284 -----------------------RSDRGIQ--RRSSFNAGKASTGGPNFVSQIESI 314
                                   .|.|..|  ::.|..|...::.|.|.|..|:.:
Mouse   543 VDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKV 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 15/46 (33%)
SEC14 101..254 CDD:238099 36/183 (20%)
Sec14l1NP_083053.2 Required for interaction and inhibitory function toward DDX58. /evidence=ECO:0000250|UniProtKB:Q92503 1..510 66/291 (23%)
PRELI 17..173 CDD:282550
CRAL_TRIO_N 256..301 CDD:215024 15/46 (33%)
CRAL_TRIO 326..490 CDD:279044 33/169 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.