DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and Sec14l4

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001102560.1 Gene:Sec14l4 / 498399 RGDID:1565810 Length:412 Species:Rattus norvegicus


Alignment Length:263 Identity:58/263 - (22%)
Similarity:109/263 - (41%) Gaps:70/263 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 REQSLEQLRNWVAKNEDLQNV-----RCDDTFLLRFLRAKKFSVPMAEQTLLKYLNIRRTFPHMS 89
            ::::|.:.|      |.||:|     :.||.||||:|||:.|.:..:|..|.|::..|.     .
  Rat    12 QQEALTRFR------EILQDVLPTLPKADDFFLLRWLRARNFDLKKSEDMLRKHVEFRN-----Q 65

  Fly    90 TQLDYL---EP-------------------------RLGDLIDQGYIFAVPQRDKHGRRVVVINA 126
            ..||::   :|                         .:|.|..:|...:..::|...:|:.|   
  Rat    66 QDLDHILTWQPPEVIRLYDSGGLCGYDYEGCPVWFDLIGTLDPKGLFMSASKQDLIRKRIKV--- 127

  Fly   127 KGLNPKIHTSCDQAKAHFLTYECLMEDQE--TQITGLTHVGDFAGVTTAHVTNWNPT--EFARIF 187
                      |:     .|.:||.::.|:  .::..:..|.|..|::..|:  |.|.  .:.:.|
  Rat   128 ----------CE-----MLLHECELQSQKLGRKVERMVMVFDMEGLSLRHL--WKPAVEVYQQFF 175

  Fly   188 KWGEQSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGS--EKELMKSVDQGCLPLE 250
            ...|.:.|...|.:.:|..|.......:.||:.:....:.:::|.|.  ::||:|.:....||:|
  Rat   176 AILEANYPETVKNLIVIRAPKLFPVAFNLVKSFIGEVTQKKIVILGGNWKQELLKFMSPDQLPVE 240

  Fly   251 MGG 253
            .||
  Rat   241 FGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 18/51 (35%)
SEC14 101..254 CDD:238099 34/159 (21%)
Sec14l4NP_001102560.1 CRAL_TRIO_N 13..59 CDD:215024 18/51 (35%)
SEC14 76..244 CDD:214706 36/188 (19%)
GOLD_2 284..379 CDD:404736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.