Sequence 1: | NP_523939.1 | Gene: | Cralbp / 38651 | FlyBaseID: | FBgn0035636 | Length: | 324 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001102560.1 | Gene: | Sec14l4 / 498399 | RGDID: | 1565810 | Length: | 412 | Species: | Rattus norvegicus |
Alignment Length: | 263 | Identity: | 58/263 - (22%) |
---|---|---|---|
Similarity: | 109/263 - (41%) | Gaps: | 70/263 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 REQSLEQLRNWVAKNEDLQNV-----RCDDTFLLRFLRAKKFSVPMAEQTLLKYLNIRRTFPHMS 89
Fly 90 TQLDYL---EP-------------------------RLGDLIDQGYIFAVPQRDKHGRRVVVINA 126
Fly 127 KGLNPKIHTSCDQAKAHFLTYECLMEDQE--TQITGLTHVGDFAGVTTAHVTNWNPT--EFARIF 187
Fly 188 KWGEQSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGS--EKELMKSVDQGCLPLE 250
Fly 251 MGG 253 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cralbp | NP_523939.1 | CRAL_TRIO_N | 31..78 | CDD:215024 | 18/51 (35%) |
SEC14 | 101..254 | CDD:238099 | 34/159 (21%) | ||
Sec14l4 | NP_001102560.1 | CRAL_TRIO_N | 13..59 | CDD:215024 | 18/51 (35%) |
SEC14 | 76..244 | CDD:214706 | 36/188 (19%) | ||
GOLD_2 | 284..379 | CDD:404736 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1471 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |