DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and CG2663

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster


Alignment Length:316 Identity:78/316 - (24%)
Similarity:142/316 - (44%) Gaps:18/316 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PEALLKIAKRELR--EDRCTREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAEQT 74
            |:..:.| :.|||  ||....|:.::.:|.|:.....|.. ..||..|..|||..|||:...::.
  Fly     8 PDQRVSI-REELREPEDPADIERDIKLIREWLETQPHLPK-DMDDMRLTTFLRGCKFSLEKVKKK 70

  Fly    75 LLKYLNIRRTFPHMSTQLDYLEPRLGDLIDQGYIFAVPQRDKHGRRVVVINAKGLNPKIHTSCDQ 139
            |..|..:|...|...:..|.....|..::|..:...:|....:|||:..|.....:.:.|...|.
  Fly    71 LDMYYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLPGITPNGRRITFIRGIDCDFQPHHILDA 135

  Fly   140 AKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPMRHKEIHLI 204
            .|...:..:..:.::...|.|...:.|.:..:.||...::||...:.....:::.|::.||:|:|
  Fly   136 MKVALMIGDVRLAEESVGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPVKVKEVHVI 200

  Fly   205 NVPSTLKWLIDFVKNRVSSKMKNRLIIYGSEKELMKSVDQGCLPLEMGGKV-PMREMIELWKQEL 268
            |:...:..:.:|||..|..|:::|:..:...:.|.|.|.:..||.|.|||. .:.|:.:.|||:|
  Fly   201 NISPLVDTIFNFVKPFVKEKIRSRITFHNDVESLYKVVPRDLLPNEYGGKAGGVVELNQWWKQKL 265

  Fly   269 ATKRDLILGLDKSILRSDRGIQRRSSFNAGKASTGGPNFVSQIESIEGSFRKLEFD 324
                     :|.:....|:..::.:.    ....|.|.....:..:||:||:|..|
  Fly   266 ---------VDNTQWFKDQEDKKANE----SLRPGAPKTSDDLFGMEGTFRQLNID 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 14/46 (30%)
SEC14 101..254 CDD:238099 35/152 (23%)
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 14/46 (30%)
SEC14 95..250 CDD:238099 36/154 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
55.020

Return to query results.
Submit another query.