DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and CG13893

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster


Alignment Length:334 Identity:64/334 - (19%)
Similarity:112/334 - (33%) Gaps:109/334 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DDTFLLRFLRAKKFSVPMAEQTLLKYL---------NIRRTFP---------------------- 86
            ||.||:|:|||:|:::..||:.|...|         ||.:..|                      
  Fly    32 DDYFLVRWLRARKWNLEAAEKMLRASLKTRAMWNVDNIEKWDPPKALQEYLPYGLMGYDNEGSPV 96

  Fly    87 --------------HMSTQLDYLEPRLGDLIDQGYIFAVPQRDKHGRR----VVVINAKGLNPKI 133
                          |..|:.:: :..|..|:::....|..|..|||.|    ||..:.:.:|.|.
  Fly    97 LVCPFANFDMWGMMHCVTRFEF-QKYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQ 160

  Fly   134 HTSCDQAKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARI--FKWGEQSLPM 196
            :.                                          |.|.....|  .|..|.:.|.
  Fly   161 YA------------------------------------------WRPAAECVISTVKQYEANFPE 183

  Fly   197 RHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGS-----EKELMKSVDQGCLPLEMGGKV- 255
            ..|..::||.|.......:.||..:.....::::||.|     :::|...|::...|...||:: 
  Fly   184 LLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGGEMV 248

  Fly   256 -----PMREMIELWKQELATKRDLILGLDKSILRSDRGIQRRSSFNAGKASTGGPNFVSQIESIE 315
                 |..:.:.:|..:|..:    |.:|:|..:|||...........|........|.:.:.:.
  Fly   249 DRNGDPQCKALMVWGGKLPEE----LYIDQSSQQSDRDFVEAQVPKGDKLKLHFKVNVEEQKILS 309

  Fly   316 GSFRKLEFD 324
            ..||..::|
  Fly   310 WEFRTFDYD 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 12/24 (50%)
SEC14 101..254 CDD:238099 30/163 (18%)
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 12/24 (50%)
SEC14 75..246 CDD:238099 33/213 (15%)
GOLD_2 303..381 CDD:290608 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.