DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and Clvs2

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001101929.1 Gene:Clvs2 / 361459 RGDID:1306801 Length:236 Species:Rattus norvegicus


Alignment Length:172 Identity:49/172 - (28%)
Similarity:86/172 - (50%) Gaps:0/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GLPEALLKIAKRELREDRCTREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAEQT 74
            ||....|:.|:.||.|:..|..|.::::|:.|....|:..:|.||.|:||||||:||....|.:.
  Rat     7 GLSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRL 71

  Fly    75 LLKYLNIRRTFPHMSTQLDYLEPRLGDLIDQGYIFAVPQRDKHGRRVVVINAKGLNPKIHTSCDQ 139
            |.:|...|:....|.......:|.:...:..|:...:...|.:||:::|:.|...:...:|..|.
  Rat    72 LAQYFEYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDI 136

  Fly   140 AKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNPT 181
            .:|..|:.|.::||.|.|:.|...:.|::..|....:...|:
  Rat   137 LRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 18/46 (39%)
SEC14 101..254 CDD:238099 19/81 (23%)
Clvs2NP_001101929.1 CRAL_TRIO_N 29..75 CDD:215024 18/45 (40%)
SEC14 103..>204 CDD:301714 19/76 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4343
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.