DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and Sec14l1

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001101779.1 Gene:Sec14l1 / 360668 RGDID:1563123 Length:720 Species:Rattus norvegicus


Alignment Length:394 Identity:81/394 - (20%)
Similarity:137/394 - (34%) Gaps:117/394 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GLPEALL--KIAKRELREDRCTREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAE 72
            |.|:..|  ...||.|.:....:|..|.:||.|:  .|..:.....|..:||||||:.|::..|.
  Rat   234 GTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWL--QETHKGKIPKDEHILRFLRARDFNIDKAR 296

  Fly    73 QTLLKYLNIRRTFPHMSTQLDYL-----EPR-LGDLIDQG-----------YIFAVPQRDKHG-- 118
            :.:.:.|..|:     ..|:||:     .|: |.|....|           |:..:.|.|..|  
  Rat   297 EIMCQSLTWRK-----QHQVDYILDTWTPPQVLQDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLV 356

  Fly   119 ---------RRVVVINAKGLNPKIHTSCDQAKAHF----LTYECLMEDQETQITGLTHVGDFAGV 170
                     |.|:.||.:||.     .|::....|    .::.||:              |..|:
  Rat   357 RALGEEALLRYVLSINEEGLR-----RCEENTKVFGRPISSWTCLV--------------DLEGL 402

  Fly   171 TTAHVTNWNP--TEFARIFKWGEQSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIY- 232
            ...|:  |.|  ....||.:..|.:.|.....:.::..|.....|...|...:....:.:.:|| 
  Rat   403 NMRHL--WRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYA 465

  Fly   233 GSEKE----LMKSVDQGCLP----------LEMGGKVPM----------REMIELWKQELATKRD 273
            |::.:    |:..:|:..:|          :..||.||.          .|.::||.:.:.....
  Rat   466 GNDYQGPGGLLDYIDKEIIPDFLSGECMCDVPEGGLVPKSLYRTPEELENEDLKLWTETIYQSAS 530

  Fly   274 LILGLDKSIL--------------------------RSDRGIQ--RRSSFNAGKASTGGPNFVSQ 310
            :..|....||                          .|.|..|  ::.|..|...::.|.|.|..
  Rat   531 VFKGAPHEILIQIVDAASVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQL 595

  Fly   311 IESI 314
            |:.:
  Rat   596 IDKV 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 15/46 (33%)
SEC14 101..254 CDD:238099 35/195 (18%)
Sec14l1NP_001101779.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 257..302 CDD:215024 15/46 (33%)
CRAL_TRIO 327..491 CDD:279044 33/184 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.