DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and CG10026

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster


Alignment Length:247 Identity:58/247 - (23%)
Similarity:114/247 - (46%) Gaps:10/247 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LPEALLKIAKRELREDRCTREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAEQTL 75
            :||.:.::| :|..|...::::.:||.||::.::.:.|..|.|..:|.:||||:.:.:..:.:.|
  Fly    24 VPEHIRRLA-QEQGECPSSKDKVIEQFRNYILEHNECQPHRSDAKYLEKFLRARYWKIENSYKLL 87

  Fly    76 LKYLNIR---RTFPHMSTQLDYLEPRLGDLIDQGYIFAVPQRDKHGRRVVVINAKGLNPKIHTSC 137
            ..|...|   ::|......||.......|::.     ..|.||:||.|:::.......|...|..
  Fly    88 CSYYRFREQNKSFYEKVRPLDLRHVGQSDILT-----VTPYRDQHGHRILIYRFGLWRPNQVTVD 147

  Fly   138 DQAKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPMRHKEIH 202
            |..:|..:..|....:..:||.|...:.|...:...|:.:.:|:...::......|:|:|...:|
  Fly   148 DIFRATIVLQELGSLEPISQIVGGVGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMPIRTSALH 212

  Fly   203 LINVPSTLKWLIDFVKNRVSSKMKNRLIIYGSE-KELMKSVDQGCLPLEMGG 253
            ::|............|..:::.|:.:|.|:||: ..|.|.::...||...||
  Fly   213 IVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHINPEHLPKRYGG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 13/46 (28%)
SEC14 101..254 CDD:238099 35/154 (23%)
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 13/46 (28%)
SEC14 112..265 CDD:238099 35/158 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
65.920

Return to query results.
Submit another query.