DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and CG10237

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_609967.1 Gene:CG10237 / 35222 FlyBaseID:FBgn0032783 Length:324 Species:Drosophila melanogaster


Alignment Length:269 Identity:71/269 - (26%)
Similarity:123/269 - (45%) Gaps:14/269 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GETTGLPEALLKIAKRELREDRCTREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPM 70
            ||.|...:   ::|.:||||....::::.::|...:....||...:.::.:|:|:||..|:....
  Fly    46 GEPTAQGK---EVAIKELRETPERQKEASKELARLLEAETDLLYPKGNEEWLIRYLRPCKYYPES 107

  Fly    71 AEQTLLKYLNIRRTFPHMSTQLDYLEPRLGDLIDQGYIFAVPQRDKHGRRVVVIN-AKGLNPKIH 134
            |...:.:|...:  ..|.....|.......::.....:...|.||:.|||::|:. .|....|..
  Fly   108 ARDLIKRYYAFK--VKHADVYTDLKPSNEANIFKHNILTVFPNRDQLGRRILVLELGKRWKHKQV 170

  Fly   135 TSCDQAKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPMRHK 199
            |..:..|...|..|..|.:.||||.|...:.|..|::......:.|....||..|.:.|:|:|.|
  Fly   171 TLDEVFKGAVLFLEAAMLEPETQICGAVVIFDMDGLSLQQTWQFTPPFAKRIVDWLQDSVPLRIK 235

  Fly   200 EIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGSEKE-LMKSVDQGCLPLEMGGKVPMREMIEL 263
            .||::|.|...:.:....|..:..|:::|:|.:|:::| |.|.:...|||...||   .||...:
  Fly   236 AIHIVNQPKIFQVVFALFKPFLKEKLRSRIIFHGTDRESLHKYMSPKCLPAAYGG---FREASRI 297

  Fly   264 ----WKQEL 268
                |.|.|
  Fly   298 DSDQWYQLL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 9/46 (20%)
SEC14 101..254 CDD:238099 45/154 (29%)
CG10237NP_609967.1 CRAL_TRIO_N 68..115 CDD:215024 9/46 (20%)
SEC14 137..290 CDD:238099 44/152 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
65.920

Return to query results.
Submit another query.