DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and Ku80

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster


Alignment Length:298 Identity:58/298 - (19%)
Similarity:118/298 - (39%) Gaps:63/298 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TTGLPEALLKIAK--RELREDR--CTREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSV 68
            |....|..||.||  .|:.:|:  |.|:..:    ::|....|...::.:|.       :....:
  Fly    16 TCAAEEVKLKSAKCVAEILKDKIVCDRKDYV----SFVLVGCDTDEIKTEDA-------SHPNVL 69

  Fly    69 PMAE------QTLLKYLN-IRRTFPHMSTQLDYLEPRLGDLIDQGYIFAVPQRDKHGRRVVVINA 126
            |..|      |.||::.. :.:|.......|:.|:..| :|.:......|.:     ||::::..
  Fly    70 PFGEPRLCSWQLLLEFFQFVNKTACEDGEWLNGLQAAL-ELQNVATTLRVAR-----RRILLLFD 128

  Fly   127 KGLNPKIHTSCDQAKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGE 191
            ....|:     |..|.:.:|.|.|.|:.|. |.| ||       ..|::.|...::...||.:..
  Fly   129 FNDFPQ-----DYEKFNEITDELLGENIEL-IVG-TH-------NIAYIDNAITSQPQAIFNFSR 179

  Fly   192 QSLP--MRHKEIHLINVPSTLKWLIDFVK--NRVSSKMKNRLIIYGSEKELMKSVD---QGCLPL 249
            :..|  :.:::..|..||.....|..|.:  :.|......|..::.::..:...:.   ||.  :
  Fly   180 KCGPDELNNQKYALSLVPRCNATLCSFKEALHTVFKVTNRRPWVWNAKLNIGSKISISLQGI--I 242

  Fly   250 EMGGKVPMREMIELWKQELATKRDLILGLDKSILRSDR 287
            .|..:.|:: ::::|.::           |:.::|..|
  Fly   243 AMKNQTPVK-LVKVWAEK-----------DEIVIRETR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 8/52 (15%)
SEC14 101..254 CDD:238099 31/159 (19%)
Ku80NP_609767.2 Ku_N 7..213 CDD:281693 48/227 (21%)
KU80 221..524 CDD:238445 8/62 (13%)
Ku_PK_bind 562..663 CDD:285938
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.