DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and CG5973

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster


Alignment Length:277 Identity:77/277 - (27%)
Similarity:137/277 - (49%) Gaps:29/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PEALLKIAKRELREDRCTREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAEQTLL 76
            ||..||.|:.||||....:||::::||..: :||...|:..||.:::.|||...:    ..::.|
  Fly    32 PEWALKKAQDELREVPGVKEQAIKELRELI-QNEKYLNLPLDDEYMMMFLRPTHY----YPESAL 91

  Fly    77 KYLNIRRTFPHMSTQLDY-------LEPRLGDLIDQGYIFAVPQRDKHGRRVVVINA-KGLNPKI 133
            |.|   :.|.||  :|.|       :..:|.::.:...:..:||||:||||::|:.| |...|..
  Fly    92 KRL---KNFYHM--KLKYGAACENIIPSKLRNVFEANILNLLPQRDQHGRRLLVLEAGKKWKPSQ 151

  Fly   134 HTSCDQAKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPMRH 198
            ....|..:...||....|.:..:||.|...:.|..|:..:|:|.:.|:..|.:..:.::.:.||.
  Fly   152 VPLVDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRL 216

  Fly   199 KEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGSE-KELMKSVDQGCLPLEMGG----KVP-- 256
            |.:|::|.......|....|..:..|::.|:..:|.: |.|:..::...||.:.||    ::|  
  Fly   217 KAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKYGGSATWELPHG 281

  Fly   257 --MREMIELWKQ--ELA 269
              :.|..|.:.:  |||
  Fly   282 KVLGEFFECYSKDYELA 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 13/46 (28%)
SEC14 101..254 CDD:238099 41/158 (26%)
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 15/52 (29%)
SEC14 116..272 CDD:238099 40/155 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
65.920

Return to query results.
Submit another query.