DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and CG31636

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster


Alignment Length:327 Identity:90/327 - (27%)
Similarity:153/327 - (46%) Gaps:33/327 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LPEALLKIAKRELREDRCTREQSLEQLRNWVAKNEDLQNVRC-DDTFLLRFLRAKKFSVPMAEQT 74
            |..||.:|..|||.|......|.:|.||:||.|...|:  .| ||.|||.|||..|||:..|::.
  Fly     7 LNAALQEICIRELNELPARMAQDIEALRDWVLKQPHLR--ACTDDQFLLAFLRGTKFSLERAKEK 69

  Fly    75 LLKYLNIRRTFPHMSTQLDY-LEPRLGDLIDQGYIFAVP-QRDKHGRRVVVINAKGLNPKIHTSC 137
            ..::..::|:.|.:..:... .:|::.|::..|.:..:| ..|..|.||.:|.|...:...|...
  Fly    70 FDRFYTLQRSIPEVFNERRLATDPQVLDIVRMGVLLQIPMDADDPGPRVTIIRAGSYDTSKHKFQ 134

  Fly   138 DQAKAHFLTYECLM-EDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPMRHKEI 201
            |..:...:..|.:| ||....::|...:.|.||||.:|:....|...::...:.::::|.|.|.|
  Fly   135 DIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTRQKGI 199

  Fly   202 HLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGSEKELMKSVDQGCLPLEMGGK-VPMREMIELWK 265
            |.||||:..:...:.:::...:|:|:|:.:......:.:.|.:..||.|.||. ..::::....:
  Fly   200 HFINVPAAFETGFNSLRSFFPAKIKSRISVSSDPAAIYELVRRKYLPQEYGGTGGNLQDISHTME 264

  Fly   266 QELAT-----KRDLILGLDKSILR---SDRGIQRRSSFNAGKASTGGPNFVSQIESIEGSFRKLE 322
            .:|::     :.....|.:..:..   ..|| ..||||.|                 .|||||||
  Fly   265 AKLSSYGPYFRESQNFGANDKLREFGDHKRG-NHRSSFGA-----------------VGSFRKLE 311

  Fly   323 FD 324
            .|
  Fly   312 ID 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 21/47 (45%)
SEC14 101..254 CDD:238099 40/154 (26%)
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 21/46 (46%)
SEC14 96..252 CDD:238099 40/155 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
44.010

Return to query results.
Submit another query.