DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and CG3823

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster


Alignment Length:326 Identity:73/326 - (22%)
Similarity:127/326 - (38%) Gaps:59/326 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ELREDR--CTREQSLEQLRNWVAKNEDL-QNVRCDDTFLLRFLRAKKFSVPMAEQTLLKYLNIRR 83
            |..||:  .||   :..|::|:.....| ||:  ....|.|||...:..:..|::.|.....:|.
  Fly     6 EKAEDQLMTTR---ISDLQDWLQAQPQLPQNI--SRLLLRRFLHTTRGDLSAAQRLLELNYGLRN 65

  Fly    84 TFPHMSTQLDYLEPRLGDLIDQGYIFAVPQRDKHGRRVVVINAKGLNPK---------IHTSCDQ 139
            ...|:....|.|:.....|:....:..:|               ||.|:         |....|:
  Fly    66 KHAHIFIDRDPLDASSQQLLQVADLVPLP---------------GLTPENNKLLFYRLIDFDADK 115

  Fly   140 ------AKAHFLTYEC--LMEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPM 196
                  .|..|:..:|  ..|::|....|...|.|.||.|..|:|...........|:.:::.|:
  Fly   116 FNFTAAIKVFFMVADCRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPV 180

  Fly   197 RHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGSEKEL-MKSVDQGCLPLEMGGKVPMREM 260
            |.||||::|.||.:..::..||..:..::...:..:....:. .:...:..||.|.||:......
  Fly   181 RLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGGEAGKMSD 245

  Fly   261 IEL-WKQELATKRDLILGLDK-SILRSDRGIQRRSSFNAGKASTGGPNFVSQIESIEGSFRKLEF 323
            ::| |.|.|..:||.::..:. .|.:..:..||:|| ::|               :....|.||.
  Fly   246 LKLQWMQLLKEQRDYLMDTENWQINKIKKNGQRKSS-DSG---------------VTEGLRSLEI 294

  Fly   324 D 324
            |
  Fly   295 D 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 11/47 (23%)
SEC14 101..254 CDD:238099 36/170 (21%)
CG3823NP_572313.1 SEC14 90..239 CDD:238099 35/163 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.