DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and CG3091

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster


Alignment Length:306 Identity:73/306 - (23%)
Similarity:119/306 - (38%) Gaps:60/306 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVQDQGETTGLPEALLKIAKRELREDRCTREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKK 65
            |.:|.|:....||.....|        ......|..|..|...|.:|.. :.:...:||||:...
  Fly     1 MDKDTGDKDSAPETSASPA--------TGWSDKLTDLVAWFEANPNLPE-KIEPIVMLRFLKCTA 56

  Fly    66 FSVPMAEQT-LLKYLN--IRRTFPH------MSTQLDYLEPRLGDLIDQGYIFAVPQRDKHGRRV 121
            |.|   |:| .|..||  :|...||      |..::.....|:.||:      .:|.....|.::
  Fly    57 FDV---ERTKALAELNYCMRNKSPHLFMDRNMEDEMTAEGLRVSDLL------ILPGVTPQGNKL 112

  Fly   122 VVINAKGLNPKIHTSCDQAK-------AHFLTYECLME---------DQETQITGLTHVGDFAGV 170
            :......|:|:...|.::.|       |.|...:...|         |:.....|...:.|..|.
  Fly   113 IFFRMADLDPRTRNSVEETKIFVMMSDARFTKPDVERETGSGADYVLDEADIAEGDVQIVDIGGY 177

  Fly   171 TTAHVTNWNPTEFARIF------KWGEQSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRL 229
            |..|:.      :..||      |:.:::.|.|.:.:|:||.|:.|..||..:...:..:::| :
  Fly   178 TLRHLA------YVSIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRN-M 235

  Fly   230 IIYGSE--KELMKSVDQGCLPLEMGGKVPMREMIELWKQELATKRD 273
            |.|.:|  ..|.|.|.:..||.|.|||.  ..:.||..:.:.:.||
  Fly   236 IRYHTEGMDSLYKEVPRDMLPNEYGGKA--GTVAELKAKGIQSIRD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 14/47 (30%)
SEC14 101..254 CDD:238099 40/176 (23%)
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 38/167 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2738
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.