DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and SEC14L3

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_011528430.1 Gene:SEC14L3 / 266629 HGNCID:18655 Length:412 Species:Homo sapiens


Alignment Length:261 Identity:61/261 - (23%)
Similarity:104/261 - (39%) Gaps:90/261 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EDLQNV-----RCDDTFLLRFLRAKKFSVPMAEQTLLKYLNIRRT--FPHMSTQLDYLEPR---- 98
            |::|:|     ..||.||||:|||:.|.:..:|..|.||:..|:|  ..|:   ||:..|.    
Human    21 ENVQDVLPALPNPDDYFLLRWLRARNFDLQKSEALLRKYMEFRKTMDIDHI---LDWQPPEVIQK 82

  Fly    99 --------------------LGDLIDQGYIFAVPQRDKHGRRVVVINAKGLNPKIHTSCDQAKAH 143
                                :|.|..:|.:|:|.::|.            |..|:. .|::    
Human    83 YMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDL------------LKTKMR-DCER---- 130

  Fly   144 FLTYECLMEDQETQITG-----LTHVGDFAGVTTAHVTNWNP--TEFARIFKWGEQSLPMRHKEI 201
             :.:||   |.:|:..|     :..:.|..|:...|.  |.|  ..:...|...|:         
Human   131 -ILHEC---DLQTERLGKKIETIVMIFDCEGLGLKHF--WKPLVEVYQEFFGLLEE--------- 180

  Fly   202 HLINVPSTLKWLI------------DFVKNRVSSKMKNRLIIYGSE-KE-LMKSVDQGCLPLEMG 252
               |.|.|||:::            :.:|..:|...:.::|:.|:. || |:|.:....||.:.|
Human   181 ---NYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIIVLGNNWKEGLLKLISPEELPAQFG 242

  Fly   253 G 253
            |
Human   243 G 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 15/37 (41%)
SEC14 101..254 CDD:238099 37/174 (21%)
SEC14L3XP_011528430.1 CRAL_TRIO_N 13..59 CDD:215024 15/37 (41%)
SEC14 76..245 CDD:214706 39/203 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.